KEGG   Acaryochloris marina: AM1_1347Help
Entry
AM1_1347          CDS       T00617                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amr  Acaryochloris marina
Pathway
amr00260  Glycine, serine and threonine metabolism
amr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01130  Biosynthesis of antibiotics
amr01230  Biosynthesis of amino acids
Module
amr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_1347 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AM1_1347 (trpA)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AM1_1347 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG TMP-TENI NanE Ribul_P_3_epim FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABW26379
UniProt: B0C6F8
Position
complement(1324768..1325571)
Genome map
AA seq 267 aa AA seqDB search
MTSVSDCFAQLRDRGQCALIPFLTAGDPDLATTASALRQLDASGADLIELGVPYSDPLAD
GPVIQAAATRALQRGTRLDQVLEMVTELSPEIRAPIILFTYYNPIYHRGVAEFLQQIAKA
GVRGLVVPDLPLEESENLLQQAADLGIEVTLLVAPTSSKERIEKIALRSQGFIYLVSTTG
VTGMRTKVENRVQDLIADLRQVTDKPIGVGFGISRTEHARQVMDWGADAAIVGSAFVNRL
SEGSPSQGLSAISTFCRSLKSSLLLDA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtttctgattgttttgcccaattgcgtgatcgcggccagtgcgccttaatt
cccttcttaacggctggagatccagatttagcaaccactgccagtgcactacgccaactg
gatgcgagtggggcagatttgatcgaattaggggttccctattctgatcccctggcagat
ggtcccgtaatccaggctgcagcaactcgagccttacagcgggggacccggctcgatcag
gtcttagagatggtgacagagctttcccccgaaattcgagcccctattattttatttacc
tactacaaccctatctatcatcgcggtgttgcagagtttctgcagcagattgcgaaagca
ggtgtgcgagggttagtggtaccggatcttcccttggaagagtcggagaacctcttgcag
caagcggctgacttgggaattgaagtgacattgctggttgcaccgactagctctaaagaa
cggattgagaaaattgccttgcgatcgcaaggctttatctacctcgtgagcaccactggg
gtcacggggatgcgcaccaaggtggaaaaccgcgtccaagatttaattgctgatttacga
caagtcacagataaacccatcggcgttggttttggcatctctcgaaccgaacatgctcgc
caagtcatggattggggcgcggatgcagcgattgtggggagtgcatttgtgaatcggttg
agtgaaggcagtcccagccagggtttatctgcaattagtacgttttgtcgatcccttaaa
tcctcgctgctattagacgcctaa

DBGET integrated database retrieval system