KEGG   Acaryochloris marina: AM1_1347Help
Entry
AM1_1347          CDS       T00617                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amr  Acaryochloris marina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AM1_1347 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_1347 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AM1_1347 (trpA)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AM1_1347 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1324768..1325571)
Genome map
AA seq 267 aa AA seqDB search
MTSVSDCFAQLRDRGQCALIPFLTAGDPDLATTASALRQLDASGADLIELGVPYSDPLAD
GPVIQAAATRALQRGTRLDQVLEMVTELSPEIRAPIILFTYYNPIYHRGVAEFLQQIAKA
GVRGLVVPDLPLEESENLLQQAADLGIEVTLLVAPTSSKERIEKIALRSQGFIYLVSTTG
VTGMRTKVENRVQDLIADLRQVTDKPIGVGFGISRTEHARQVMDWGADAAIVGSAFVNRL
SEGSPSQGLSAISTFCRSLKSSLLLDA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtttctgattgttttgcccaattgcgtgatcgcggccagtgcgccttaatt
cccttcttaacggctggagatccagatttagcaaccactgccagtgcactacgccaactg
gatgcgagtggggcagatttgatcgaattaggggttccctattctgatcccctggcagat
ggtcccgtaatccaggctgcagcaactcgagccttacagcgggggacccggctcgatcag
gtcttagagatggtgacagagctttcccccgaaattcgagcccctattattttatttacc
tactacaaccctatctatcatcgcggtgttgcagagtttctgcagcagattgcgaaagca
ggtgtgcgagggttagtggtaccggatcttcccttggaagagtcggagaacctcttgcag
caagcggctgacttgggaattgaagtgacattgctggttgcaccgactagctctaaagaa
cggattgagaaaattgccttgcgatcgcaaggctttatctacctcgtgagcaccactggg
gtcacggggatgcgcaccaaggtggaaaaccgcgtccaagatttaattgctgatttacga
caagtcacagataaacccatcggcgttggttttggcatctctcgaaccgaacatgctcgc
caagtcatggattggggcgcggatgcagcgattgtggggagtgcatttgtgaatcggttg
agtgaaggcagtcccagccagggtttatctgcaattagtacgttttgtcgatcccttaaa
tcctcgctgctattagacgcctaa

DBGET integrated database retrieval system