KEGG   Acaryochloris marina: AM1_1388Help
Entry
AM1_1388          CDS       T00617                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_1388 (hemD)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AM1_1388 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368130..1368993
Genome map
AA seq 287 aa AA seqDB search
MTDLLLSTARLPLGNKRIVITAPRPYAGRLATAIIQQGGLPIVMPTIETYALDPAPDLDH
ALQQLRDFSWVAFTSRTGIQAVMLRLQQLDIPLFLLNQCHICAIGQDADQLQTLGVRVDL
IPKESSPAGLVAELAQIPDIDTRRIFVPIPQVERIPEPDIVPKFLADLEQLGLTVVSVPA
YVTRRLEATAYAVEVEQIRQGKVDAIAFSSTAEISALLQMVDAETLMKHCVIACFGPYTA
GNAKDLGLSVDIVSQDFSSFTGFTAAIAQFFHPASADIPRQDPVILP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctactgctatcgacagcacgcctgcctctgggcaataaacggattgtcatt
acggctcctcgaccctatgccggacgtctagcgacggcaatcatccagcaaggggggttg
cccatcgtcatgcccacgatagagacctatgcattagaccctgctcccgatttggatcac
gccttgcaacagctcagggatttttcgtgggttgctttcaccagtcgcacaggtattcaa
gccgttatgctgcggttacaacagctcgatatccccttatttcttctcaatcaatgccat
atttgcgccatcggccaagatgcagaccaactgcaaacgttaggcgttcgtgttgatcta
attcccaaggaatcgagtcctgcgggccttgtggcagagctggcacaaatccctgacata
gacacccggcgaatttttgtaccgattccccaggtggagcggataccggagccagatatc
gtgcccaaattccttgccgatctggagcaattgggattaaccgttgtatcagtgcccgct
tatgtcacacgtcggctggaggccacggcctatgccgtcgaggtggaacagattcgccag
ggtaaggtggatgcgatcgcatttagcagtaccgctgaaatctcggccttgctgcagatg
gtggatgccgaaaccctaatgaagcattgtgtgatcgcctgttttggtccctataccgct
gggaacgcaaaagacttagggctatccgttgatatcgtgtcccaggactttagttcattt
acaggctttaccgcagccatcgctcaatttttccacccagcttccgcagatatccctagg
caggaccccgtaattttgccgtaa

DBGET integrated database retrieval system