KEGG   Acaryochloris marina: AM1_1527Help
Entry
AM1_1527          CDS       T00617                                 

Definition
delta-9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amr  Acaryochloris marina
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1510777..1511619)
Genome map
AA seq 280 aa AA seqDB search
MTIATPPSQLKRDWTFIVVLIAIHIGALFAFVPSNFSWAAVGFAVFFHWVTGGLGITLGW
HRMLTHRSFKTPKWLEYFLVFCGSLACEGGVIWWVGLHRNHHMHSDTDLDQHNSRNGFWW
SHMGWMIHEIPAEADIDKLTKDINTDPFYRFLDDYFFPMQIVFGVLLYFIGGWPLVVWGI
FVRLVLVYHCTWFVNSATHKFGYKTYESDDQSTNCWWVALLTYGEGWHNNHHAFPQSARH
GLQWWEIDTTWMMVQLLQSLGLADKVRLPNAQQLASNDGT
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgcaacaccgccatcacagcttaagcgtgattggacctttattgtggtccta
attgctatccatattggagcattgtttgccttcgtacccagcaactttagctgggcagcc
gtgggctttgccgtcttttttcactgggttaccggtggacttggtatcaccctgggttgg
catcggatgctcacccaccgcagtttcaaaacccccaagtggttggagtattttctcgtc
ttttgcggatccttagcctgtgagggcggcgtgatttggtgggttggcttgcatcgcaat
caccatatgcattctgatacggatctggatcagcataattcccgtaatggcttctggtgg
agtcatatgggctggatgattcatgaaatcccagcggaagcagacattgacaaactgacg
aaagatatcaataccgatcccttttatcggtttttggatgactacttcttccccatgcaa
attgtgtttggggtattgctgtacttcattggcggctggcctctagtggtttggggtatt
tttgtccgcttggtgttggtgtatcactgcacttggtttgtaaatagcgccacccataag
tttggctataaaacctatgagtctgatgatcaatccaccaactgctggtgggttgcccta
ctcacctatggtgaaggctggcataataatcaccatgcttttcctcaatcggctcgccat
ggcttgcaatggtgggaaattgacaccacttggatgatggtgcagttactccaatctctg
ggcttagcagataaagtccgcctgccgaatgctcaacagctagcatccaatgatggtacc
tag

DBGET integrated database retrieval system