KEGG   Acaryochloris marina: AM1_1694Help
Entry
AM1_1694          CDS       T00617                                 

Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
amr  Acaryochloris marina
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AM1_1694
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AM1_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673750..1674988
Genome map
AA seq 412 aa AA seqDB search
MVGVKPTDQQYPQGLVGFILCAYPAPRTLPHRRQLREYEFVCATEQMRSQWMNAIRQALQ
GHPIQPQQAVRPRHLQVLVNPKGGRRQAKQVFQSIQPILEDAHCQVSILETQGGEGTIQA
VRDFDLSAIDGFVVVGGDGTVYELINGLMTHGDAEVAIAKPIGIIPAGTGNGLGKTILDL
SQETYDPSNAAFIIAKGQYQPINLGVVKQDGKEYYSILSLAWALISDIDIKSNKLRFLKF
LGSLRSDLYAFLSILALRSYRGRISFLPAPDWPPSPDTPQPDLLAEPQPADIETSTASAW
QVLEGEFIALWVMNVAWATHSVLAAPHARLADGYMDVLIIRKGITRWRLLTAFLKIATGE
HLLIPEMEYYKVRCLHLEPLSSEGLLAVDGEQIKYRSVEMNVLANHAQVFCR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgtcaagccgactgatcagcaatatccccaaggactcgttgggtttattctg
tgtgcctatcctgctcctaggactttaccccaccgccgacagttacgggaatatgagttt
gtctgtgccacggagcagatgcgctcccagtggatgaacgccattcgccaagcgttacag
ggccaccccatccaaccccagcaggccgtcaggccccgccatctccaagtcttagtcaat
cccaagggaggacggcgacaagccaaacaagtctttcaatccattcagcccattttagaa
gatgcccattgccaggtgagcattttggaaacccaggggggcgaaggaacgatccaggcc
gtgcgagatttcgacttatcagcgatagatggatttgtcgttgtcggtggcgatggaacg
gtttatgagctgattaacgggctgatgacccatggggatgcggaggttgcgatcgcaaaa
cccatcggcatcatcccagccggtaccggcaacggtctgggaaaaaccattctcgaccta
tcccaagaaacctacgatccgagtaatgccgcgtttatcatcgccaaaggccagtaccag
cctattaatttaggcgtcgtcaaacaggatggcaaagaatattacagcattctctcctta
gcttgggctttgattagcgatatcgatattaagtccaacaagcttcgttttctcaagttc
ctaggctccttacgtagtgatctctatgcttttctcagcatcttggccctccgcagttat
cgaggtcggatttcctttctacctgccccagactggccacctagccccgatacccctcag
ccagacctcctagccgaaccgcagccagcagacatcgagacctctacagcttcagcttgg
caagtgcttgagggtgagtttattgccctttgggtgatgaacgtcgcttgggccacccat
agcgttttggcagccccacacgctcgattagccgatggctacatggatgtcttaatcatt
cgtaaaggaattacccgctggcgtttattaaccgcatttctgaaaattgccacaggcgaa
catctcctgattccagagatggaatactacaaggtgcgctgtctccacttagaacctcta
agttctgaaggcttactggctgttgacggagaacaaatcaaataccgctccgttgaaatg
aatgttttggcaaaccatgcccaagttttttgccgttaa

DBGET integrated database retrieval system