KEGG   Acaryochloris marina: AM1_2085Help
Entry
AM1_2085          CDS       T00617                                 

Gene name
ccp
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amr  Acaryochloris marina
Brite
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AM1_2085 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2078277..2079356)
Genome map
AA seq 359 aa AA seqDB search
MTLQWHHGNRDKIHRFIVFWVVVAATLLIFLRGSEIAIADEAPNLALFGPPLPENFYPQQ
QPADPELVDLGRSLYFEKRLSKNQDISCNSCHQLDHYGVDNQPFSPGHKGQLGGRNSPSV
YNAAAHVAQFWDGRAADVEAQAKGPILNPVEMAMPSEAQVLKVLNSMPEYVEAFATAFPK
DKQSVTYDHLGQAIGAFERGLVTPAPFDRYFAGDQTALNAKQKRGLTLFVDAGCAQCHNG
TYFGGNTYQKAGRVNPWPNQEDQGRYKVTGDEYDRMLFKVPSLRNVAKTGPYFHDGSVKS
LKAAVVQMANTQLGKDLSNSEAGDIVAFLESLTGEPPTDYIQPPVLPVSTESTPAADPT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcaatggcatcacggcaaccgcgataagatccatagatttattgtgttttgg
gtggtagtggcagcgaccttgctgatattcctccgcggatcggaaattgctatcgcagat
gaagctcccaacctcgcactatttggtcctcccttacctgagaatttctaccctcagcag
caacctgccgatcctgaacttgtggacttaggtcgcagtctctactttgaaaagcgcctg
agtaaaaatcaggatatttcttgcaatagctgtcaccagcttgatcactatggtgttgat
aaccaacccttttcccctggccataaagggcagctcggagggcgtaactctccttcggtg
tataacgctgctgcccatgtggcccaattttgggatggccgtgctgccgatgtagaagct
caagcgaaaggcccgattctcaatccggtggagatggcgatgccctccgaggctcaggtc
ctgaaagtcctcaattccatgccggaatatgtggaagcctttgccacagcctttcccaaa
gataagcagtcggttacttacgatcacctcggtcaagccatcggtgccttcgagcgaggt
ctcgttacccctgctccctttgatcgctattttgcaggtgatcaaaccgctttaaatgcc
aaacaaaaacggggtctaaccctttttgtggatgcaggctgtgcccaatgtcataacggc
acctattttggcggtaacacctatcaaaaagcaggtcgagttaatccttggccgaatcaa
gaggatcaaggacgctacaaagtcacgggtgatgagtatgatcgaatgctctttaaggtg
ccatccttgcgcaacgtagcgaagacaggtccctatttccacgatggttctgtcaaatcg
ctaaaagcggctgtggtgcaaatggctaacactcagttggggaaagatctctctaattcg
gaagctggggatattgtcgcctttctagagtctttaactggagaacctcccacagattat
atccagccccctgttttgcctgtcagtacggaaagtactcctgctgctgacccgacttaa

DBGET integrated database retrieval system