KEGG   Acaryochloris marina: AM1_2103Help
Entry
AM1_2103          CDS       T00617                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amr  Acaryochloris marina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AM1_2103 (malQ)
Enzymes [BR:amr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AM1_2103 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092190..2093710)
Genome map
AA seq 506 aa AA seqDB search
MPFPRASGLLLHPTSFPGRFGVGDLGPEAYRFVDFMVQSGQQLWQVLPLGPTGFGNSPYM
CYSAMAGNPLLISLEQLQEQELLQEEDLELGVGFRPETIAYEQVIPMKQGLLRLAYDNFK
AGVFPELALAFQKFCQTRAWLEDFAFFMALKDAHWGAAWNTWPQEIAQRQPAAMAEWQQK
LQSDIEMHKFWQFQFFQQWSNLKQYANDNGIQIIGDIPIYVAHNSSDVWSNPDQFFLDPE
TLEPALMAGVPPDYFSETGQLWGNPIYQWKRMEKQGFKWWIQRFRTMLDYVDLIRVDHFR
GFRAFWQVKQGENTAMNGEWVVAPGDELFEALRDELGKLPILAEDLGIITPDVEELRDKF
EFPGMKILHFAFGSGSGNPYLPFNHVQNCLVYTGTHDNNTTVGWFHDMPDHERVFVEGYM
GGLSQEGIHWDLIRLALSSVANQVIIPVQDLLGLGTEARMNLPSTSGGNWAWRYRSGGLT
DAIAERLLQLTDTYGRAPVKTDDSWD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcccccgagctagtggccttctcctgcatccgacgtcgtttccaggtcgattt
ggagttggtgacctagggccagaagcctatcgattcgttgattttatggtccaaagtggt
cagcagctatggcaggtgctgcccctagggccaacggggtttggtaactccccctacatg
tgttattccgcaatggcgggcaatcccctcttgattagtctggagcaactacaggagcag
gagctattgcaagaggaagatctggagctaggcgtgggctttcgcccggagaccatcgcc
tacgagcaggtcattcccatgaagcaggggctgctacggctggcctatgacaatttcaaa
gcgggcgtttttccagagcttgccctcgcgtttcagaaattttgccaaaccagagcctgg
ctggaagatttcgccttttttatggccctcaaggatgcccattggggggcggcctggaat
acgtggccccaagaaattgcccagcgccaacctgctgctatggcggagtggcagcaaaag
ctgcagtccgatatcgagatgcataagttttggcaatttcagttttttcagcaatggtcc
aatctgaaacagtacgccaacgataacggcattcaaatcattggtgatattcccatctac
gtcgcccacaatagttcagatgtgtggtcgaatcccgatcagtttttcctcgatccagaa
acccttgaacccgcgctgatggctggcgtgcccccggattactttagtgaaaccggacag
ctctggggcaatcccatctaccagtggaagcgaatggagaagcaaggctttaaatggtgg
attcagcgcttccgcaccatgctggactatgtggatctgattcgggtagatcacttccgg
ggcttccgagccttttggcaggtcaagcaaggggaaaatactgccatgaatggcgagtgg
gttgtagctcctggagatgagctgttcgaagccctgcgagatgagctgggcaagctgccg
attttggcggaagatctgggcatcattacccctgatgtggaggaactccgggataagttt
gaatttccgggcatgaagattctccattttgcctttggttctggttcgggtaatccctac
ctaccctttaaccatgtgcagaactgtttggtctacacaggcacccatgacaacaacacg
acggtgggctggtttcacgatatgcctgaccatgagcgggtgtttgtggagggctatatg
ggcggcttgtcccaggaaggcatccactgggatttaattcgactggccctcagttcggtg
gcaaatcaggtgattatccctgtgcaagatctgctggggctaggcactgaggcccgcatg
aacttacccagtacatcagggggcaactgggcttggcggtatcgttcgggtggattgacg
gatgcgatcgcagaacggttactgcaactcacggatacctacggtcgtgccccagtcaaa
acagatgactcctgggattag

DBGET integrated database retrieval system