KEGG   Acaryochloris marina: AM1_2833Help
Entry
AM1_2833          CDS       T00617                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
amr  Acaryochloris marina
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AM1_2833 (speB)
Enzymes [BR:amr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AM1_2833 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876119..2877315
Genome map
AA seq 398 aa AA seqDB search
MAENSTFGPPNSDPNFSSTEANRALEKEAQLPLTGWQQEVDRGLELGLEAAASIRDRSIP
TFSRGELPHYAGINTFLKAPYLEDVRKVDEYDIAVVGVPHDSGTTYRPGTRFGPQGIRRI
SALYTPYNFELGIDLREQITLCDVGDIFTIPANNEKSFDQISKGVAHIFSSGAFPIILGG
DHSIGFPTVRGVCRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNL
VQLGIGGWQVPRQGVKVCRERATNILTVTDITEIGLDAAVDFALERALDGTDCVYISFDI
DCIDAGFVPGTGWPEPGGLMPREALYMLGKIIQKAPVCGLEIVEVSPPYDISDMTSLMAT
RVICDTMAHLVLSGQLPRQKAPDYIHPEANMAVGSEWV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaactcgacctttggtcctcccaattctgatcctaatttttcgtccactgag
gccaatcgtgctttagagaaagaagcacaattgcccctcacgggctggcaacaagaagtt
gaccggggattagaactggggttagaagcggcggctagtattcgcgatcggagcatcccc
accttctcgcgaggcgagctgccccactatgcgggcatcaataccttcctcaaagcgcct
tacctagaagatgtgcgtaaagtcgatgaatacgatattgctgtagtaggcgttccccat
gactccggcaccacttatcgtcccggtacgcgcttcggcccccagggtattcgtcggatt
tcagccctgtatactccttataatttcgagctgggtatcgatttacgagagcagatcacc
ctctgcgatgttggggatatcttcaccatccccgccaataatgagaaatcttttgaccaa
atttccaaaggagtcgcccatatcttcagttctggcgctttccctatcatcttagggggc
gatcattccattggtttccccactgttcgaggggtttgccgccatttaggggacaagaaa
gtcggtatcatccacttcgatcgccatgtggatacccaagaaacggatttagacgagcgc
atgcatacctgcccttggtttcatgccactaacatggccaatgctccggctaaaaactta
gtgcaattaggcattggcggttggcaagtgcctcgacaaggggtcaaggtctgtcgagag
cgagccacgaatattctcaccgtcaccgatatcactgaaattggacttgatgctgccgtt
gacttcgccttagaacgagccttagacggcacagactgcgtctatatcagctttgatatt
gactgtattgatgctggatttgtccccggtaccggctggccagaacccggcggtctgatg
ccccgagaagctctctatatgttgggcaaaattattcaaaaagcccccgtctgcggcttg
gaaatcgttgaagtgtcacccccttatgacatcagcgatatgacctcgctcatggccact
cgggtcatttgcgataccatggcccatcttgtgctgtcggggcaacttccccggcaaaaa
gcaccagactatattcatcctgaagccaatatggcagtaggttctgagtgggtttag

DBGET integrated database retrieval system