KEGG   Acaryochloris marina: AM1_3500Help
Entry
AM1_3500          CDS       T00617                                 

Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amr  Acaryochloris marina
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AM1_3500
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AM1_3500
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AM1_3500
Enzymes [BR:amr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AM1_3500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540704..3542269
Genome map
AA seq 521 aa AA seqDB search
MLNRRQFLLTVGAVMGLVVLRDQSPPILAQPQFSAYPFSLGVASGDPRPDSVVLWTRLAP
NPLSGQPMPAVAIPVQWQIATDAQMTEVIQQGTTQATPQWGHSVHVVADNLSPSQWYWYQ
FQVGSETSPIGRTRTLPALDTDPEQLKFAFVSCQHYEKGYFTAYQHLVQEDLDLVFHLGD
YIYEGGPHKGRPRQHIGPNPIDLETYRLRYALYKNDPQLQAAHAAFPFICIWDDHEVDED
YAQDQSQNYDDPNVFRKRRWAAYQAYYEHLPLRPTAQPQNGQVQLFRRFQFGQLAEFHCL
DNRQYRDDQPCATEGIGGGAIVSACQDRLAADHSMLGKPQEAWLIQGLQNSSAHWQVIAQ
QQLMAELKFGLETVSGYWTDGWDGYAASRQRILDVVEQRPLKNVVVIGGDIHAFGVADLK
TNFQDPQSPIIGTEFVGTSISSTGLPQALYSLSQKINPHIKFLDTRHRGYVLCQITREVW
TAHLRIVNSVEQSESTIRTLASFQVKNGQPGAIPIEAMANP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcgacgacagtttttgttgacggtgggggcagttatgggtcttgtcgttctc
agggatcagtcgcccccgatcttggctcagccccaattttctgcctatccctttagccta
ggcgttgcctccggcgatcctcgacccgatagcgttgtcctctggacacggttagcccct
aaccctttatcggggcaacctatgcctgcggttgctattcctgttcagtggcagattgca
acggatgcccagatgaccgaggtgattcaacagggaacgacccaggctacgccacaatgg
ggacattccgttcatgtggtggcagacaatttgtctccaagccagtggtattggtatcaa
ttccaagtggggtcagaaacaagcccgattggtcgaactcgaaccctgccggccttggac
acagaccctgagcagttaaagtttgcgtttgtgtcttgccagcattacgaaaagggatac
ttcacggcctatcaacatctcgttcaagaagatttagatctggtctttcacttgggggac
tatatctatgaaggcggtcctcacaaagggcggcccagacaacatatagggcctaacccc
atcgatctagagacgtatcgtctacgttatgccctgtacaaaaacgacccccaattgcag
gccgcccatgcagcatttccctttatctgcatttgggatgaccatgaagtcgatgaagac
tatgcccaagaccagtcccaaaactatgatgaccctaatgtctttcgcaaacgtcgatgg
gcagcctatcaagcctattatgagcatctgccgttacggcccactgctcagcctcaaaac
ggccaagtccaactgtttcgtcgcttccagtttggccaattagctgagtttcattgctta
gataaccgccagtatcgggacgatcaaccttgcgccactgagggaataggaggaggcgcg
atagtctcagcctgccaagaccgtttagcggctgaccattccatgctgggtaaaccacaa
gaggcttggctgatccaggggctacaaaactcttccgctcattggcaggtgattgcccaa
caacagctgatggcagaactgaagtttggtctggaaacagtatctgggtattggacagat
ggctgggatggctatgccgcctcacgccaacgcatcttggatgttgttgagcaacgcccc
ctgaaaaatgtggttgtgattgggggagacattcatgcttttggggttgcagatctaaag
acaaattttcaggatcctcagtcccctatcattgggactgaatttgtgggtacctccatt
agttctacggggctaccgcaggcgctctattccctcagtcaaaaaataaatcctcacatc
aaatttttggatacccgccatcgaggctatgtcctttgtcagatcacgcgggaggtttgg
actgcccatttacgcatcgttaattccgtcgaacagtctgagtccactattcgaaccctg
gcttcttttcaagtcaaaaatggccaacctggagccattcccatagaagccatggcaaac
ccttga

DBGET integrated database retrieval system