KEGG   Acaryochloris marina: AM1_3528Help
Entry
AM1_3528          CDS       T00617                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
amr  Acaryochloris marina
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3566433..3567452
Genome map
AA seq 339 aa AA seqDB search
MTAFDPNGVGLENGNLFGLPFDFDSAQIIVWGIPWEVTVSYGSGTAQGPAAILRESPQLD
LYDFDHPGGWQQGIYLAGIPDFILAKNDEIKAKAQAVIEHTSQGHTVADSSTLMTALTEV
NQECRHLNQWIYQQAQTVLAQGKKLALLGGDHSIPLGYLQALAEQYDEFGILQIDAHSDL
RQAYQGFEFSHASIMANVLKLPQVRKLVQVGVRDVCAAEVETVAQSQGRIVTYYDPDLKT
QLYQGTTWHSLCQEMVTHLPQQVYISFDVDGLDPKLCPHTGTPVPGGLELEAAFYLCRRI
VHSGRSLIGCDICEVGNGVWDGNVGARILYKLCNLMGLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctttgatcctaatggcgtgggcctagaaaatggcaatctgtttggcctgccc
ttcgactttgacagtgcccagattatcgtttggggcattccctgggaagtgacggtttcc
tacggttctgggacagctcaaggaccagcagcgattctgcgagagtccccacagttggat
ttatacgattttgatcatccaggtggctggcagcaaggtatttatctggcgggcattccc
gactttatcctggctaaaaatgatgagataaaagccaaggctcaagccgtgattgagcat
accagtcaaggccatacggttgccgattcatccaccttgatgaccgcgctaacggaagtg
aatcaggaatgtcgccaccttaatcagtggatttatcagcaagcccaaactgttctggct
caggggaaaaagctggcacttttaggcggagaccacagcattcccttgggctacttgcag
gcattggctgagcagtatgacgaatttggtattcttcaaatcgatgcccattccgattta
cgtcaagcctatcaagggtttgaattttcccatgcatcgattatggctaatgtcttgaaa
ctgccccaggtcaggaagcttgttcaggtgggggtgcgggatgtctgtgcggctgaagtt
gaaaccgtcgctcaatcccagggacgaattgtgacctactatgatccagacctgaagacg
cagctttatcaagggacgacttggcactccctttgccaagagatggtgacgcatcttcct
cagcaggtctacattagttttgatgtggatgggttagaccccaagttatgcccccacacg
ggtactccggttccgggtggattggagttggaagcagctttttatctgtgtcgaaggatt
gttcacagtgggcgatcgctcattggctgtgatatctgtgaagtggggaatggggtgtgg
gacggcaatgtgggtgctcgaattctctacaaactctgtaatttgatggggctatcttag

DBGET integrated database retrieval system