KEGG   Acaryochloris marina: AM1_3568Help
Entry
AM1_3568          CDS       T00617                                 

Definition
(GenBank) diguanylate cyclase (GGDEF domain), putative
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
amr  Acaryochloris marina
Brite
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AM1_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF Response_reg Baculo_PP31 DUF4795 Alpha-mann_mid Phage_GP20 Nitroreductase DUF4363
Motif
Other DBs
NCBI-ProteinID: ABW28558
UniProt: B0C2A6
Position
3616504..3617766
Genome map
AA seq 420 aa AA seqDB search
MPEDKSLLSAGTLEADDELQFLEELACHSQREVIPGGWKVIVVDDEEQVHEVTRLALKNF
KFADKPLEIISAYSSEEAQQLLNQNPDTAVLLLDVVMETDEAGLELVKHIRDHLHNIFVR
IILRTGQPGIAPEKSVIEGYDINDYKTKTELTQQKLFSTLITAIRSYRDLLTVEESRQQI
AYLNQQLEDAKLSLENKVKERTQALQQQTLALAAKNKQLEEEIQAKLYAQQALEATNKKL
DEANKQLSLIANHDALTGLANRRRFDEYLQQIWKQTQREQQPLSLLICDIDFFKQYNDTY
GHLEGDICLRTVAQKIHQTIVRPLDLVARFGGEEFAIVLPNTDLEGGQVVAERLRMIIQK
SQLPHRGSSVSEFVTVSIGAATVRSHPHTSVSSLISRADQALYQAKQSGRDQVVALSITE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggataaatccttgctttctgcaggaactctagaagccgatgatgaactccag
tttttggaagagttagcctgccattcccagagggaggtgattccaggaggatggaaagtc
attgtagtggacgatgaagaacaggttcatgaggtgacgcgtctcgccctgaaaaacttc
aaatttgctgataagcccctggaaattatttcggcttattccagtgaagaagctcagcag
ttattgaatcaaaacccagatacagcggtgttgctgttagatgtggtgatggagacggat
gaagctggcctagagctggtcaagcatatccgtgatcatttacacaacatctttgtgcgg
attattttacgcactggtcagccgggtatcgctcccgaaaaatcggtgattgaagggtat
gacattaatgactacaaaactaaaaccgaactcacccaacaaaaacttttttccacgtta
attacggctattcgatcgtatcgagatttactgactgttgaagagagccgtcaacagatt
gcgtatttaaatcaacagttagaagatgccaaactcagtttggagaataaggttaaagaa
cgcacccaagcgctgcagcagcaaaccttagccttagcagctaaaaacaagcagctagaa
gaagagattcaggccaagctctatgcccagcaggctttagaagcgaccaataagaagttg
gatgaagccaataagcagctgtctctgattgcgaatcatgatgccctcacggggttggcg
aaccgccgtcgttttgatgagtatttacaacaaatttggaagcaaactcagcgggaacaa
cagcccttaagccttttaatttgcgatattgattttttcaagcagtataacgatacctat
ggtcacctagagggagatatttgcctccgaacggtggcccaaaagattcaccaaaccatt
gtgcgtcctttggatttagtggcccgctttggaggggaagaatttgcgattgtgttgccc
aataccgatttagagggagggcaagtggtggcggagcgcctgagaatgatcatccagaag
tctcaacttccccatcgtggatcttctgtgagcgaatttgtgaccgttagcattggggcc
gctacggtgcgatcacatccccatacctccgtatcgagcttaatcagccgagccgatcag
gccctctatcaagcgaaacaatctggacgagaccaggtggttgctctatcgataacggag
tag

DBGET integrated database retrieval system