KEGG   Acaryochloris marina: AM1_3568Help
Entry
AM1_3568          CDS       T00617                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3616504..3617766
Genome map
AA seq 420 aa AA seqDB search
MPEDKSLLSAGTLEADDELQFLEELACHSQREVIPGGWKVIVVDDEEQVHEVTRLALKNF
KFADKPLEIISAYSSEEAQQLLNQNPDTAVLLLDVVMETDEAGLELVKHIRDHLHNIFVR
IILRTGQPGIAPEKSVIEGYDINDYKTKTELTQQKLFSTLITAIRSYRDLLTVEESRQQI
AYLNQQLEDAKLSLENKVKERTQALQQQTLALAAKNKQLEEEIQAKLYAQQALEATNKKL
DEANKQLSLIANHDALTGLANRRRFDEYLQQIWKQTQREQQPLSLLICDIDFFKQYNDTY
GHLEGDICLRTVAQKIHQTIVRPLDLVARFGGEEFAIVLPNTDLEGGQVVAERLRMIIQK
SQLPHRGSSVSEFVTVSIGAATVRSHPHTSVSSLISRADQALYQAKQSGRDQVVALSITE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggataaatccttgctttctgcaggaactctagaagccgatgatgaactccag
tttttggaagagttagcctgccattcccagagggaggtgattccaggaggatggaaagtc
attgtagtggacgatgaagaacaggttcatgaggtgacgcgtctcgccctgaaaaacttc
aaatttgctgataagcccctggaaattatttcggcttattccagtgaagaagctcagcag
ttattgaatcaaaacccagatacagcggtgttgctgttagatgtggtgatggagacggat
gaagctggcctagagctggtcaagcatatccgtgatcatttacacaacatctttgtgcgg
attattttacgcactggtcagccgggtatcgctcccgaaaaatcggtgattgaagggtat
gacattaatgactacaaaactaaaaccgaactcacccaacaaaaacttttttccacgtta
attacggctattcgatcgtatcgagatttactgactgttgaagagagccgtcaacagatt
gcgtatttaaatcaacagttagaagatgccaaactcagtttggagaataaggttaaagaa
cgcacccaagcgctgcagcagcaaaccttagccttagcagctaaaaacaagcagctagaa
gaagagattcaggccaagctctatgcccagcaggctttagaagcgaccaataagaagttg
gatgaagccaataagcagctgtctctgattgcgaatcatgatgccctcacggggttggcg
aaccgccgtcgttttgatgagtatttacaacaaatttggaagcaaactcagcgggaacaa
cagcccttaagccttttaatttgcgatattgattttttcaagcagtataacgatacctat
ggtcacctagagggagatatttgcctccgaacggtggcccaaaagattcaccaaaccatt
gtgcgtcctttggatttagtggcccgctttggaggggaagaatttgcgattgtgttgccc
aataccgatttagagggagggcaagtggtggcggagcgcctgagaatgatcatccagaag
tctcaacttccccatcgtggatcttctgtgagcgaatttgtgaccgttagcattggggcc
gctacggtgcgatcacatccccatacctccgtatcgagcttaatcagccgagccgatcag
gccctctatcaagcgaaacaatctggacgagaccaggtggttgctctatcgataacggag
tag

DBGET integrated database retrieval system