KEGG   Acaryochloris marina: AM1_3589Help
Entry
AM1_3589          CDS       T00617                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
amr  Acaryochloris marina
Pathway
amr00340  Histidine metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    AM1_3589 (hisD)
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AM1_3589 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABW28579
UniProt: B0C2C7
Position
complement(3638422..3639717)
Genome map
AA seq 431 aa AA seqDB search
MLRTITQQTEAIAELRRICDRTQDDSLLHKESTVREILASVQRQGDLALLQYTAEFDHLT
LSLDQLKVSGAELDAAYQQIPQERLDAIRSYSQQIKAFHLKQRRQSQVHFGDHQVVVGQR
YTPVDRVGLYIRGTQNISPSQILLNAIPAVVAGVPNIVMLTPPSPEQQMHPAVLVAAQEA
GIEAIYRVGGAQGIAALAYGTATIPAVDVIAGSGNIYVTLAKKLVYGSVGLDALTGPSEL
VILADHTANPSYIAADLLAHAESDPLAAAILITSDTTLATKVVLEVNQTLSGYGILTEKA
IAHYGLVITVDDIQNATSLVNGMAPAQVSLALHDPWRLVEHIRHAGSILMGSHTPPSAGQ
LLVGANPNLPTAGTARYSSGPGVETFMKQTHLIQYSANALSHSAQHLDTLVQLEEETAQS
LSLRIRSKQSE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaaccattacccagcaaacggaggcaattgcagaactgagacggatttgcgat
cgcactcaggatgactctcttcttcacaaagaatcgaccgttcgagaaatcctagcatcg
gtccaacgccaaggtgacttagccctgcttcaatataccgctgagttcgaccatctcact
ttaagcctagaccagctcaaagtgagcggtgccgaactagatgcggcatatcagcagatt
cctcaagagcgattggacgctattcggtcttattcccagcagattaaagcctttcacctc
aagcaacgccgtcaaagtcaggttcactttggtgatcaccaagtcgtggtgggtcaacgc
tacacccccgtggatcgggtaggtctttatatccgagggactcaaaacatttctcctagt
caaatccttttaaatgcgattcctgccgttgtcgctggtgtccccaacattgtgatgttg
acgccacccagtccggaacaacagatgcatcctgccgtactagtcgcagcccaggaagct
ggcatcgaagcgatttaccgggtgggaggtgcccaaggcattgcagctttggcctatggg
acggccacgattcctgcggtagatgttattgccggtagtggaaatatctacgtcaccctg
gcgaagaaattagtgtatggctctgtaggcctcgatgctctaaccggaccttcagaactg
gttattctggcagatcataccgccaatccttcgtatattgctgcggacctactagcacac
gctgaatccgacccccttgcagcagctattttaatcacctcagatacaaccctggcaacc
aaggtcgtcttggaagtgaatcagaccttatccggctatgggatattgacggaaaaagcg
atcgcccactatggcttagtcattactgtagacgatatacaaaacgcgacgtccctcgtc
aatgggatggcccccgctcaggtttcccttgcccttcatgatccttggcgtttagtggag
catattcgccatgctggctccattctcatggggtctcacacgcctccctcagcaggtcag
ttgctggtaggtgccaatcccaatctaccgactgcaggaacagcacgttatagctctggc
cctggagtcgagacctttatgaagcaaactcatttaatccaatattcggccaacgcttta
tcccactcggctcaacacttagataccctcgtccagctagaggaggaaaccgcacaatca
ctctccctgcgcattcgatccaaacagtctgagtaa

DBGET integrated database retrieval system