KEGG   Acaryochloris marina: AM1_3649Help
Entry
AM1_3649          CDS       T00617                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amr  Acaryochloris marina
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AM1_3649
Enzymes [BR:amr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     AM1_3649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3705045..3706850
Genome map
AA seq 601 aa AA seqDB search
MIDRAQQHQAFTIKVKALLERIYGPDSLEPLLEQLFELLQPHFADSISENLYKWSQDNIL
LITYGDTICSQNGNPPLGTLHHFLKTYLQDVVTGVHILPFCPFSSDDGFSVIDYKAVNHE
LGTWEDIQQIAQSFELMADLVLNHVSSQSQWFQNYLQGIEPGRDYFVEVDPEIDVSSVVR
PRSSPLLVEVETLAGPKYVWATFSADQIDLDFSNPQVLLEFTKILLFYVQMGAKYIRLDA
IGYLWKRLGTSCIHLPETHAMVRLFREILEMVDPSVALITETNVPNRENLSYFGNRNEAH
LIYNFSLPPLILNALLQGKAEHLKTWMMSMPPAPLGCAYFNFTASHDGIGLRPTEGLLTE
TEYQTLLQCMEDFGGTLSMRTNAEGIDSPYEINISFFDALQGTAKGKDQWQIERFICSQT
IMMSLEGIPAFYIHSLLATHNDWENVHRTGRKRSINRHQWSLPALEQQLEDEQSPHAIVL
KELTRLIKIRRQQDAFHPNATQYTLHLPNKALFAFWRQSMARDQSIFSIHNLSDRKQKLK
LSDLNLVTIDPWYDLISGACIRGIYDTLLLNPYQSLWITNKFEGLEADGQTCHLEVEGDD
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcgagcccaacagcatcaagccttcaccatcaaagtgaaagccctgctggaa
agaatttatggtccagattccctagaaccattactcgaacagcttttcgaactgttacaa
ccccatttcgcggattccatctctgagaacttgtataagtggagtcaagacaacattctg
ttgattacctatggagataccatttgctcgcagaatggtaaccctcctttgggcacatta
catcacttccttaagacctatctgcaggatgtggtgactggggtgcatatcttaccgttt
tgtcccttcagttctgatgatggtttttcggttatcgactataaggctgttaatcatgaa
ctaggcacttgggaagatattcagcagattgctcagtcctttgaactcatggctgacttg
gtgcttaaccatgtttctagccaaagccaatggtttcagaattatttgcagggtattgaa
ccggggcgcgactattttgtcgaagtcgatccggagatagatgtctctagcgtcgtccga
cctcggagttctcctttactagtcgaagtagagactctagcaggtcccaagtatgtttgg
gcgacatttagtgccgatcaaattgacttagatttttcgaatcctcaggttctcctcgaa
tttactaaaattctgctgttttatgtgcaaatgggtgccaagtatattcgtttggatgcc
attggttacttatggaagcggttagggacctcctgtattcatttacctgaaacccatgcc
atggtgcgattgtttcgggaaattctggaaatggtggatccatcggtggcgctgatcact
gaaaccaatgtgcccaaccgtgaaaacctcagctactttggcaatcgcaacgaagcccat
ttaatctacaatttcagcttgccgcccctgatattgaacgcgttgcttcagggtaaggct
gagcatttaaagacctggatgatgagtatgcccccagctcctctgggatgtgcctacttc
aactttacggcctcccatgatggtattggtttacgaccgacggaaggccttttaactgaa
actgaatatcaaacgctcctccaatgtatggaagactttggtggcaccctcagtatgcgc
accaatgctgaaggcattgattcaccctatgaaattaatatttccttcttcgatgctctg
caaggcacggccaaaggcaaggatcaatggcagatagaacgctttatctgctcccaaacg
atcatgatgtctttggaaggaatcccagccttttatattcatagtttgttggctacccat
aatgattgggagaatgtccatcgtacagggcgcaagcggtccattaatcgccatcaatgg
tctctccctgctttagaacagcagttagaggatgaacaatctccccatgcaattgtcctg
aaagagttgactcggctcatcaaaattcgccgccaacaagatgcctttcatcccaacgct
acccaatacaccctgcatttgcccaataaagcgttatttgctttttggcgacaaagtatg
gcccgagatcagagcattttttcaattcataatctcagcgatcgtaaacagaaactgaag
ctctcggacctgaacctagtcaccattgatccctggtatgacctgattagcggggcttgt
attcgaggcatttatgacactttgctcttgaacccctatcaatccctatggattacgaat
aagtttgaaggtctagaagccgatgggcaaacctgtcacttagaagtcgaaggagacgat
gactaa

DBGET integrated database retrieval system