KEGG   Acaryochloris marina: AM1_3815Help
Entry
AM1_3815          CDS       T00617                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase, putative
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00520  Amino sugar and nucleotide sugar metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
amr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_3815 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    AM1_3815 (ppgK)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AM1_3815 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABW28802
UniProt: B0C5T1
Position
3866599..3867315
Genome map
AA seq 238 aa AA seqDB search
MGTPADESLLVLSVDIGGSGIKAMVLDESGQPITERQRIETPSYPNPPAVLDVIVELAKG
QGDFNRVSVGFPGVVQNGVIKTAVNLNKEWIDYDLAKNLEARLDAPVRVANDADIQGYGA
ISGQGVELVVTLGTGFGSALFVNGHLVPNLEIAHHPFIKGKTYEQQLGRQAMKKKGKKAW
NRHLAQAIKNLEHLFNYDRLYMGGGETKRVKIDLSDNVEIVSNRAGILGGIALWRDRG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggtacccctgctgatgaatctcttttagtcttatccgttgatattggcggtagtggg
attaaagccatggttttagacgaaagcggtcaacccatcaccgagcgccagcgcattgaa
accccttcttatcccaacccgcctgctgttttagatgtgattgttgaactggccaaagga
caaggagatttcaaccgtgtgtccgtgggctttccaggggtggttcaaaatggcgttatc
aaaacagccgtgaatctcaataaagaatggattgattacgacctagcgaaaaatttggaa
gcgcgtttggatgcccctgtgcgcgtggccaatgatgcagatattcaaggctatggggcc
atctcaggccaaggggtagagctagtcgttaccctggggactggctttgggtcggcatta
tttgtgaatggtcacctcgtgcccaacctagaaattgcccatcacccttttatcaaaggc
aaaacctacgaacagcagctggggcgtcaagctatgaagaaaaaaggcaagaaagcctgg
aatcgtcatttagcccaagcgatcaagaacctcgaacacctgtttaactatgaccggctg
tatatgggaggaggcgaaaccaaacgggtcaagatcgatctctccgacaatgttgaaatt
gtcagtaatcgagccggtattctcggtgggattgccctctggcgagatcgaggctga

DBGET integrated database retrieval system