KEGG   Acaryochloris marina: AM1_3917Help
Entry
AM1_3917          CDS       T00617                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amr  Acaryochloris marina
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3969894..3970496)
Genome map
AA seq 200 aa AA seqDB search
MSTVYTRPLARLVEQLQRLPGIGPKSAQRLALHLLKRPTAEVEALANALIEAKQQVGFCS
VCFHLSADPVCDICRAPSRDKTVICVVADSRDVIALEKTREFKGQYHVLGGLISPMDGIG
PDQLNVQPLIRRVHQTKTQEVILAINPSVEGETTTLYVGQLLKPFTRVTRIAFGLPMGGD
LEYADEVTLARALEGRRDLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacggtttatacccggcccctagcccgactggttgagcagctccaacgactcccc
ggcattggccccaaaagtgcccaacgactagccctgcacctgttaaaacgccccactgcc
gaggtcgaagccctcgccaatgccctaatcgaggccaagcagcaggtcggattttgttct
gtctgctttcatttgtccgccgaccctgtctgcgatatttgtcgggcacccagtcgagat
aaaacggtgatttgcgtggttgccgattctagggacgtgattgccctcgaaaaaacccga
gaattcaagggtcaatatcatgtgctcggcggtttgatttcacccatggatggcattggc
cccgatcagctcaatgttcagcccctcattcgccgggttcatcaaacaaaaacccaagag
gtgattctggccattaaccctagtgtagaaggcgaaaccaccaccctgtatgtggggcaa
ctgctcaaaccctttacgcgcgtgacgcgcattgcctttggtctccccatgggaggtgac
ttagaatatgcagacgaagtcacccttgctagagcactagaagggcgacgagatttggat
taa

DBGET integrated database retrieval system