KEGG   Acaryochloris marina: AM1_3947Help
Entry
AM1_3947          CDS       T00617                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM1_3947 (pfkA)
   01230 Biosynthesis of amino acids
    AM1_3947 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_3947 (pfkA)
   00030 Pentose phosphate pathway
    AM1_3947 (pfkA)
   00051 Fructose and mannose metabolism
    AM1_3947 (pfkA)
   00052 Galactose metabolism
    AM1_3947 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AM1_3947 (pfkA)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AM1_3947 (pfkA)
Protein phosphatases and associated proteins [BR:amr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AM1_3947 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3997173..3998255)
Genome map
AA seq 360 aa AA seqDB search
MGDTKRIGILTSGGDCAGLNPTIRAVVLRAVEHYGWEVIGIQQATHGLLKDPPAAMALQP
QQMSPLLTAGGTMLGTTNKGNPFAFPMPDGTLIDRSEDMIDGYRKLGLDALIGIGGDGSI
AILRKLAQQGNWNLVGIPKTIDNDVGVTERSVGFDTAVNIATEALDRLQFTAASHSRVII
LEVMGRDAGHIAISAGIAGGADIILIPEIPYTIDNVCAIIKERQSKGKNYSLIIVAEAVR
TEGGDPLTHTDGLGECRLGGIGQYLSEQICSRHVAETRVTVLGHVQRGGIPSPSDRLIGA
AFGVAAVDLIAERQFDQMVTWQNRQVMSVPIADAIAHYRAVDPTGTLVKTARGLGIYLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatacaaaacggatcggtattctgacgagcggcggtgattgtgcagggcttaac
cccacgattcgcgcagtcgtgcttcgagcagttgaacattatggttgggaagtgatcggg
attcaacaagccacccatggtttattgaaagatccgcctgcagccatggcgctgcaacct
caacagatgagtcctttactcaccgcaggagggacgatgttaggaacaaccaacaagggg
aatccctttgcctttccgatgccagatggcacgctgatcgatcgctcagaagatatgatt
gacggctatcgcaagctgggcttagacgctctgatcgggattggcggcgatggtagcatc
gccattctccgtaagctagcccaacagggtaattggaacttggtgggcattcccaaaacc
atcgacaatgatgtgggagtaacggaacgatcggtcggatttgatacggcggtcaatatt
gccacagaagccctagaccgcttgcaatttactgcagccagccatagccgtgtcattatc
ctggaggtgatgggtcgggatgcgggtcatattgcgatcagtgcaggtattgccggaggg
gcagatatcatcttgattcctgaaattccctacaccattgataatgtctgcgccataatc
aaagaacgccagagtaagggcaaaaactattctctgataatcgtggctgaggcggtgcgg
actgagggcggtgatcccttaacccatacagatggattaggcgaatgccgtctgggggga
atcggccaatatttatctgagcaaatttgcagtcgtcatgtggccgaaacccgggtgaca
gttttagggcatgttcagcgcggcggcataccgtccccttccgatcgactaattggggca
gcgtttggcgttgcggccgtcgatttgattgctgaacgtcagtttgatcaaatggtgact
tggcaaaatcgccaggtgatgagtgttccgattgctgatgcgatcgcacattacagagcc
gtcgaccccaccggaacgctggtcaaaaccgccagaggtttagggatttacctaggagac
tag

DBGET integrated database retrieval system