KEGG   Acaryochloris marina: AM1_4369Help
Entry
AM1_4369          CDS       T00617                                 

Gene name
gapA
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM1_4369 (gapA)
   01230 Biosynthesis of amino acids
    AM1_4369 (gapA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_4369 (gapA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AM1_4369 (gapA)
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     AM1_4369 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4398773..4399777
Genome map
AA seq 334 aa AA seqDB search
MIRVAINGFGRIGRNFMRCWLLRPNSNIEIVGLNDTSDPKTNAHLLTYDSMLGRLDADIK
AVDNTIVANGHVIKCVSDRNPANLPWKDWDIDLVIESTGVFVTKEGASKHIEAGAKKVLI
TAPGKGGVGMYVVGVNHEDYDPSEPILSNASCTTNCLAPVVKILHEQFGIVHGLMTTTHS
YTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVGTVIPALQGKLNGIALRVPTPNVS
VCDFVAQTEKPAIAESVNEVLKQASESSMKGIIAFNEEPLVSGDFKGHDCSSIVDGSLTM
GMGGNMIKVVAWYDNEWGYSQRVLDLAEYVAQKW
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgatcaacgggttcgggagaattggacgaaattttatgcgttgttgg
cttttacggccgaacagcaacatcgagattgtcggattaaatgatacttctgaccccaaa
acaaatgcccacctgttgacctatgactccatgctgggtcgtttagatgcagacattaaa
gcagtcgataacacgattgtcgcgaatggccatgtcattaaatgtgtctctgatcggaac
cctgctaacctgccttggaaagattgggacatcgatctagtgatcgaatctacaggcgtg
tttgtcaccaaagaaggagcgagcaagcatattgaagctggcgccaaaaaagtattaatc
acagcccctggtaagggtggtgtgggtatgtatgtggttggggtaaaccatgaggattat
gatcccagcgagcccattctcagtaatgccagttgtacaaccaactgtttggcccctgtg
gttaaaatcttgcatgagcagtttggaattgttcatggcttgatgaccaccactcacagc
tacactggcgaccagcgcattctagatgccagccaccgagatttgcgacgggctcgtgct
gctgcagttaacattgtgccaacttccactggtgctgccaaagcagtgggtactgtgatt
cctgcactgcaagggaagctcaacggtattgccttgcgggtgccaacccctaacgtgtca
gtttgtgactttgttgcccaaactgagaagccagcgattgctgagtctgttaatgaagtt
cttaagcaagcgtctgaaagctcaatgaaaggaatcattgctttcaacgaagagcctttg
gtctcaggtgacttcaagggacatgattgttcttctattgttgatggttcccttaccatg
ggcatgggcggcaacatgatcaaggttgtagcttggtatgacaatgagtggggttatagt
cagcgcgtgcttgacctagctgagtatgttgctcagaagtggtaa

DBGET integrated database retrieval system