KEGG   Acaryochloris marina: AM1_4389Help
Entry
AM1_4389          CDS       T00617                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00051  Fructose and mannose metabolism
amr00562  Inositol phosphate metabolism
amr00710  Carbon fixation in photosynthetic organisms
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
amr01200  Carbon metabolism
amr01230  Biosynthesis of amino acids
Module
amr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_4389 (tpiA)
   00051 Fructose and mannose metabolism
    AM1_4389 (tpiA)
   00562 Inositol phosphate metabolism
    AM1_4389 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AM1_4389 (tpiA)
Enzymes [BR:amr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AM1_4389 (tpiA)
Exosome [BR:amr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AM1_4389 (tpiA)
  Exosomal proteins of bladder cancer cells
   AM1_4389 (tpiA)
  Exosomal proteins of melanoma cells
   AM1_4389 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABW29368
UniProt: B0CEX1
Position
4419271..4419996
Genome map
AA seq 241 aa AA seqDB search
MRKIAIAGNWKMHKTQAEALEFLQTFLPLLQDTPEDRDVILCAPFTTLTALSKNLHGSRV
QVGAQNIHWEDTGAFTGEISGPMLLETGVRYVVVGHSERRQFFGETDATVNQRLKAAQNH
RLTPILCVGESKAQRDANETETVIFEQLEKGLVGVDQKNLIIAYEPIWAIGTGDTCASSE
ANRVIGLIRSRLTNHDVTIQYGGSVKPDNVDEIMAQPEIDGALVGGASLAGDGFARVVNY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaattgcgatcgcaggcaactggaaaatgcacaaaactcaggcagaggccctg
gagtttttgcaaacctttctacccctgctacaagatacccctgaagatcgagatgtgatt
ctctgtgcacctttcaccacattgacggccctctccaagaacttacatggcagtcgggtg
caagtcggggcgcaaaatatccactgggaagataccggcgcgtttacgggcgaaatctcg
gggccgatgctgctggaaactggcgtccgctatgtcgttgttggtcacagtgaacgtcgc
cagttttttggtgaaacggatgctaccgtgaatcagcgactcaaggctgctcaaaaccat
cgcctgactccaattctctgtgtcggtgaatcaaaggctcagcgagatgccaatgagacc
gaaacggttatctttgagcagcttgaaaaaggtctggtgggtgtcgatcaaaagaactta
atcattgcctacgaacctatttgggccatcggcacaggggatacctgtgcgagtagtgaa
gccaatcgagtcattggtttaatccgttctcgactaaccaaccacgatgtcaccattcaa
tatggtgggtcggttaagccagataatgtggatgaaattatggcccagccagaaatagat
ggtgctctggtcggtggcgctagtttggctggcgacggtttcgcgcgggttgttaattat
cagtaa

DBGET integrated database retrieval system