KEGG   Acaryochloris marina: AM1_4389Help
Entry
AM1_4389          CDS       T00617                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM1_4389 (tpiA)
   01230 Biosynthesis of amino acids
    AM1_4389 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_4389 (tpiA)
   00051 Fructose and mannose metabolism
    AM1_4389 (tpiA)
   00562 Inositol phosphate metabolism
    AM1_4389 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AM1_4389 (tpiA)
Enzymes [BR:amr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AM1_4389 (tpiA)
Exosome [BR:amr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AM1_4389 (tpiA)
  Exosomal proteins of bladder cancer cells
   AM1_4389 (tpiA)
  Exosomal proteins of melanoma cells
   AM1_4389 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4419271..4419996
Genome map
AA seq 241 aa AA seqDB search
MRKIAIAGNWKMHKTQAEALEFLQTFLPLLQDTPEDRDVILCAPFTTLTALSKNLHGSRV
QVGAQNIHWEDTGAFTGEISGPMLLETGVRYVVVGHSERRQFFGETDATVNQRLKAAQNH
RLTPILCVGESKAQRDANETETVIFEQLEKGLVGVDQKNLIIAYEPIWAIGTGDTCASSE
ANRVIGLIRSRLTNHDVTIQYGGSVKPDNVDEIMAQPEIDGALVGGASLAGDGFARVVNY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaattgcgatcgcaggcaactggaaaatgcacaaaactcaggcagaggccctg
gagtttttgcaaacctttctacccctgctacaagatacccctgaagatcgagatgtgatt
ctctgtgcacctttcaccacattgacggccctctccaagaacttacatggcagtcgggtg
caagtcggggcgcaaaatatccactgggaagataccggcgcgtttacgggcgaaatctcg
gggccgatgctgctggaaactggcgtccgctatgtcgttgttggtcacagtgaacgtcgc
cagttttttggtgaaacggatgctaccgtgaatcagcgactcaaggctgctcaaaaccat
cgcctgactccaattctctgtgtcggtgaatcaaaggctcagcgagatgccaatgagacc
gaaacggttatctttgagcagcttgaaaaaggtctggtgggtgtcgatcaaaagaactta
atcattgcctacgaacctatttgggccatcggcacaggggatacctgtgcgagtagtgaa
gccaatcgagtcattggtttaatccgttctcgactaaccaaccacgatgtcaccattcaa
tatggtgggtcggttaagccagataatgtggatgaaattatggcccagccagaaatagat
ggtgctctggtcggtggcgctagtttggctggcgacggtttcgcgcgggttgttaattat
cagtaa

DBGET integrated database retrieval system