KEGG   Acaryochloris marina: AM1_4654Help
Entry
AM1_4654          CDS       T00617                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_4654
Enzymes [BR:amr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     AM1_4654
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AM1_4654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4687446..4689074
Genome map
AA seq 542 aa AA seqDB search
MSENNYSTTQTPKSQGKVFIIGAGPGEHNYLTVMGQNLLAQADVILYDALINPELLNLVK
KTCLKIPVGKRGKGPSTPQTEIDRRLVAYCCQGYQVVRLKSGDPFVFGRTTSEVLALHAA
GCAVEVLPGISSALAAPLFAGIPLTDAQLGQHFTVLSAHAPERLDWSVLAQLDTLVILMG
ARQLETIVHHLRHHSQPEQHPIAIIRWGGRRQQQVWTGTLGTIVAQTQGESLSPCVIVVG
KVVNLQPTLGLSFPTNSEYAHRSDSAQCSMGATSLQSTLPLAGKTILVTRAVAQSKTFSQ
SLMSMGATVVDMPALEIGPPSSWKALDGAIASLDRFDWLILTSANGVTRFLDRLFHAGLD
TRALASVKIAVVGRKTAKTLEQQGLKADYIPPNFVADALVEHFPGEALTGQTLLFPRVES
GGRDVLVKQLTQKGATVVEVAAYQSRCPATIAPQALHALRTQTVDIVTFASSKTVRYFYQ
LLQQAVGEGKPQAWLTPLKVASIGPQTSLTCQELLGRVDIEAEEYTLDGLTQSIVDHYQT
QD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaaaacaactattcaacaactcaaacgcctaagtcacagggcaaggtttttatc
attggtgctggccctggggaacataactatcttacggttatgggacaaaacctgcttgct
caggctgacgtcatcctctatgatgccctgatcaatcctgaattattaaacctcgtaaag
aaaacttgcttaaaaatcccagttggtaagcgaggtaagggtcctagcactccccaaaca
gagattgatcgccggttagtggcgtattgttgccagggatatcaagttgtccgtcttaaa
agtggtgatccctttgtgtttggacgcaccacgtctgaagtcctcgccttacacgcagca
ggttgtgcggttgaagtgttgccggggatttcttctgccctagcagcacctttatttgct
ggcattccccttactgatgcccaattgggccagcactttacggtattgagtgcccatgcc
ccagagcgtctggactggtctgttttagcccaactcgataccttggtgattctgatgggg
gcgcgccagttagaaaccatcgtccatcacctgagacaccatagccagcccgaacaacat
ccgattgccattattcgttggggaggtcggcgtcagcagcaagtttggactggcacgttg
gggacgattgtggcccaaacccaaggagagtccctatcgccttgtgtaatcgtggtgggc
aaagtcgttaatctccaaccaaccctgggactttctttcccgaccaacagtgaatatgct
catagaagtgattctgcacaatgttccatgggtgctacttctcttcagtcaactttaccg
ttagcaggtaaaacgatcttggtgacgcgagccgttgcccaatccaagacctttagtcaa
tctcttatgtcgatgggggcgacagtcgtggatatgccggcattggaaattggcccgcct
tcgtcttggaaggcgttagatggtgcgatcgcatctttagatcgctttgactggctgatc
ttgacgtctgccaatggcgttactcgcttcctagaccgtctattccatgccggcttagat
acgagagcactcgcttccgtcaagattgcagtggtcggtcgaaaaacagccaaaacttta
gaacagcaaggattaaaggcggactatatcccacctaacttcgttgcggatgctttagta
gagcatttcccaggggaagcactgacggggcagaccctgttattccccagagttgaaagt
ggtggacgagacgttttggtcaaacaattgacccaaaaaggggcaacagtggtggaggtg
gctgcctatcaatcacgatgtccagcaaccattgctccccaggccctccatgccttgcga
actcaaaccgttgatatcgtcacctttgccagttctaaaacggttcgctatttttatcag
cttctgcagcaagcggttggagagggtaaaccccaggcatggcttactcccctcaaggtc
gcctccattggtcctcagacttcattgacctgccaagagctgctgggacgagtcgatatt
gaagcggaggaatataccttagacggtttaacgcaaagtattgttgaccactatcagact
caagattag

DBGET integrated database retrieval system