KEGG   Acaryochloris marina: AM1_4654Help
Entry
AM1_4654          CDS       T00617                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4687446..4689074
Genome map
AA seq 542 aa AA seqDB search
MSENNYSTTQTPKSQGKVFIIGAGPGEHNYLTVMGQNLLAQADVILYDALINPELLNLVK
KTCLKIPVGKRGKGPSTPQTEIDRRLVAYCCQGYQVVRLKSGDPFVFGRTTSEVLALHAA
GCAVEVLPGISSALAAPLFAGIPLTDAQLGQHFTVLSAHAPERLDWSVLAQLDTLVILMG
ARQLETIVHHLRHHSQPEQHPIAIIRWGGRRQQQVWTGTLGTIVAQTQGESLSPCVIVVG
KVVNLQPTLGLSFPTNSEYAHRSDSAQCSMGATSLQSTLPLAGKTILVTRAVAQSKTFSQ
SLMSMGATVVDMPALEIGPPSSWKALDGAIASLDRFDWLILTSANGVTRFLDRLFHAGLD
TRALASVKIAVVGRKTAKTLEQQGLKADYIPPNFVADALVEHFPGEALTGQTLLFPRVES
GGRDVLVKQLTQKGATVVEVAAYQSRCPATIAPQALHALRTQTVDIVTFASSKTVRYFYQ
LLQQAVGEGKPQAWLTPLKVASIGPQTSLTCQELLGRVDIEAEEYTLDGLTQSIVDHYQT
QD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaaaacaactattcaacaactcaaacgcctaagtcacagggcaaggtttttatc
attggtgctggccctggggaacataactatcttacggttatgggacaaaacctgcttgct
caggctgacgtcatcctctatgatgccctgatcaatcctgaattattaaacctcgtaaag
aaaacttgcttaaaaatcccagttggtaagcgaggtaagggtcctagcactccccaaaca
gagattgatcgccggttagtggcgtattgttgccagggatatcaagttgtccgtcttaaa
agtggtgatccctttgtgtttggacgcaccacgtctgaagtcctcgccttacacgcagca
ggttgtgcggttgaagtgttgccggggatttcttctgccctagcagcacctttatttgct
ggcattccccttactgatgcccaattgggccagcactttacggtattgagtgcccatgcc
ccagagcgtctggactggtctgttttagcccaactcgataccttggtgattctgatgggg
gcgcgccagttagaaaccatcgtccatcacctgagacaccatagccagcccgaacaacat
ccgattgccattattcgttggggaggtcggcgtcagcagcaagtttggactggcacgttg
gggacgattgtggcccaaacccaaggagagtccctatcgccttgtgtaatcgtggtgggc
aaagtcgttaatctccaaccaaccctgggactttctttcccgaccaacagtgaatatgct
catagaagtgattctgcacaatgttccatgggtgctacttctcttcagtcaactttaccg
ttagcaggtaaaacgatcttggtgacgcgagccgttgcccaatccaagacctttagtcaa
tctcttatgtcgatgggggcgacagtcgtggatatgccggcattggaaattggcccgcct
tcgtcttggaaggcgttagatggtgcgatcgcatctttagatcgctttgactggctgatc
ttgacgtctgccaatggcgttactcgcttcctagaccgtctattccatgccggcttagat
acgagagcactcgcttccgtcaagattgcagtggtcggtcgaaaaacagccaaaacttta
gaacagcaaggattaaaggcggactatatcccacctaacttcgttgcggatgctttagta
gagcatttcccaggggaagcactgacggggcagaccctgttattccccagagttgaaagt
ggtggacgagacgttttggtcaaacaattgacccaaaaaggggcaacagtggtggaggtg
gctgcctatcaatcacgatgtccagcaaccattgctccccaggccctccatgccttgcga
actcaaaccgttgatatcgtcacctttgccagttctaaaacggttcgctatttttatcag
cttctgcagcaagcggttggagagggtaaaccccaggcatggcttactcccctcaaggtc
gcctccattggtcctcagacttcattgacctgccaagagctgctgggacgagtcgatatt
gaagcggaggaatataccttagacggtttaacgcaaagtattgttgaccactatcagact
caagattag

DBGET integrated database retrieval system