KEGG   Acaryochloris marina: AM1_4805Help
Entry
AM1_4805          CDS       T00617                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amr  Acaryochloris marina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AM1_4805 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_4805 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AM1_4805 (trpB)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AM1_4805 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4842508..4843764)
Genome map
AA seq 418 aa AA seqDB search
MAVTPLSSADQSSGAQQYPDALGRFGPYGGKYVPETLMPALAELESALAQYRNDPEFQAE
LSQLLKDYVGRPSPLYFAERLTTHYARPDGSGPQIYLKREDLNHTGAHKINNALAQALLA
KRMGKQRIIAETGAGQHGVATATVCARFGFDCVIYMGVQDMERQALNVFRMRLLGAEVHP
VEAGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRQQCQE
QWNGTPDILLACVGGGSNAMGLFHEFVPDTQIRMIGVEAAGAGVNTDKHAATLTQGEAGV
LHGAMSYLLQDEDGQVLEAHSISAGLDYPGVGPEHSFLKDSGRCEYYSVTDTEAVAAFQR
LTELEGIIPALETSHAIAYLETLCPQLEGSPRIVISCSGRGDKDVQTVAKFLEQQSPQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttactcccctatcctctgctgaccaatcctctggcgcacaacaatatcctgat
gccttgggtcgctttggtccctacggtgggaaatatgtccccgaaactctgatgcctgcc
ctggcagaactggaatctgccctcgcccagtaccgaaacgatccagagtttcaggcagaa
ctcagccaactgctcaaagactatgtaggtcggcctagccccctgtattttgccgagcgg
ctaaccacccactatgcccgtcccgatggcagtggtccccagatctatttaaagcgagaa
gaccttaaccatacaggagcccataaaatcaacaatgccctcgctcaagccttgctcgct
aagcggatgggcaaacagcgaattattgctgaaacgggcgctggacagcatggggtggca
acagcaactgtctgtgcccgctttggctttgactgtgtgatttatatgggggtccaggat
atggaacgtcaggccctcaatgtatttcggatgcggctattaggggcagaagttcatccg
gtggaagcgggaacaggaacccttaaggatgccacctcggaagccattcgcgactgggtg
actaacgtagaaaccacccactatattttgggttctgtggctggtccccacccctatcca
atgatggtgcgagatttccatgccgtgattggccaagagactcgccagcaatgccaagag
caatggaatggtacccccgatatcttgctcgcctgcgtggggggtgggtcaaatgcgatg
ggtttatttcatgagtttgtgcctgatactcaaatccgcatgattggtgtggaggccgct
ggcgctggcgttaatactgataaacatgcagccacgctcacccaaggggaagctggggtg
ctgcacggggccatgagttatctgctacaagatgaagatggtcaggtgttagaggcccat
tctattagtgcgggactggattatcctggcgtgggccctgagcatagttttcttaaggat
agtggccgctgtgaatattacagcgtcacggatacagaggctgttgcggcctttcagcga
ctaacggaactggaagggattattccggccctggaaacgagtcatgcgatcgcatatctg
gaaaccctctgtccccagctagaaggcagtccccggattgttatttcctgttcgggtcgg
ggcgataaagatgtccaaaccgtagctaagtttttagagcagcaatctccccagtag

DBGET integrated database retrieval system