KEGG   Acaryochloris marina: AM1_4852Help
Entry
AM1_4852          CDS       T00617                                 

Gene name
chlH
Definition
magnesium protoporphyrin IX chelatase H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_4852 (chlH)
Enzymes [BR:amr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AM1_4852 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4894328..4898113)
Genome map
AA seq 1261 aa AA seqDB search
MARIVLIAGFESFNIDLYIRAAELAQARCPGLEVRIFSDRDINADPEAVTAALQGADVFF
SSLVFDYDQVLWLRERVQDIPIRLVFESALELMSLTQLGKFVIGEKPKGMPKPVKYILDK
FGSGKEEDKLAGYISFLKVGPKLLKYVPGKKVQDLRNWLIIYGYWNAGGPENVAAMCWTL
AEKYLNLPLNAEIPPPIETPNIGLLHPDYEGYFESPQDYLDWYKINRLPFLWKAGATSTT
QHIHFAQPPVVGILLYRKHVITKQPYIPQMIRKFEEAGLIPLPIFINGVEGHVAVRDLMT
TRHEQGQRQQGTKEILSLSEKAAEVDAIVSTIGFPLVGGPAGSMEAGRQVAVAKQILSAK
NVPYLVAAPLLIQDIYSWTRQGIGGLQSVVLYALPELDGAIDTIPLGGLVGNDIYIVPER
VDRLTGRLKQWIALRQKPMAERKLAILLYGFPPGYGATGTAALLNVPKSLLSLLRSLKSQ
GYNVGDLPEDGEEIVNWVREADNGLVDPAQMNGHAGTTSVNVRQLERWLGYLLTHRIEKQ
WDSLTGTGIKTNGEEFSVGGIQMGNVWIGVQPPLGLSGDPMRLMFERDLTPHPQYAAFYK
WLQNGFQADGVIHFGMHGTVEWLPGSPLGNTGYSWPDVLLGNIPNLYIYAANNPSESILA
KRRGYGVLISHNVPPYGRAELYKELAALRDLIQEYREDPEKNAVLREAICKKIIDAGIDA
DCPFQEAKQLGIEFTPENARMFSAEAFNHYLVELYEYLQVLETRLFSSGLHVLGESPDAE
KLGSYLQAYFGEELPEDAIAAVATGEESDQIRQRFELNGSTPKLEEALQIRSLLAQTGDE
LTNLLRGLNGEYVPPAPGGDLLRDGPGVLPTGRNIHALDPYRMPSPAAYERGREIARKIL
AQNLEDKGTYPETVAVMLWGLDAIKTRGESIGILLELVGAEPIKEGTGRIVRYGLTPLEQ
LDHPRVDVLANLSGIFRDSFVNIIELLDDLFLRAAEADEPPAQNFIRKHALALKEQGVEN
VSARLFSNPAGDFGSLVNDRVTDSNWESSDELGQTWSDRNAFSYGRNDKGQARPEVLQTL
LKSTEQIVQEIDSVEYGLTDIQEYYANTGGLKLAAEQQRGSKVKANFVESFSKDTTPRDL
DSLLRMEYRTKLLNPKWADAMADQGSGGAYEISQRMTALIGWGGTADFQEGWVYDQAAET
YALDPEMAEKLRQANPEAFRNIVGRMLEAHGRGFWSPDQDILDQLRALYELTDEELEGIT
A
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atggcacggattgttctgattgcgggatttgaatcctttaacatcgatttatatatcaga
gctgccgagctagcccaggcgcgctgtccaggtttggaggtgcggatctttagcgatcgc
gatattaacgctgacccagaagccgtcaccgccgccttgcaaggagcggatgtcttcttt
agcagcttagtcttcgactacgaccaagtgctgtggctacgggagcgggtgcaggatatt
cccatccgcttggtatttgaatcggcgttggaactgatgagcctcacccagctcggcaag
tttgtaattggcgagaagcccaaagggatgcccaagcccgtcaaatacatcctggataaa
tttggtagcggtaaagaagaagacaaactcgccgggtatatcagctttctgaaggtcggt
cctaaactgctcaagtatgtccccggcaaaaaggtccaggatctgcgtaactggctgatt
atttacggctactggaatgctggggggcctgagaatgtggccgccatgtgttggaccctg
gcagagaaatacctcaacttacccctcaacgcggaaattccaccccccattgagaccccc
aatattggtctactccatccagattatgaagggtattttgaatctcctcaggactatctg
gactggtacaaaattaatcggctgcccttcctttggaaagcgggagcaacctccacaacc
caacatatccactttgcccagcctccagttgtggggattctgctgtatcgcaagcatgtc
atcaccaagcagccctatattccccaaatgattcgtaagtttgaggaagcagggctgatt
cctttacccatttttattaacggggtggaaggccatgtggccgtgcgcgatttaatgacc
acccgccacgaacagggtcaacgccagcagggcaccaaagaaattctgtccttgtctgaa
aaagcggctgaggtggatgcgattgtctcgacaattggttttcccctcgtcggcggaccc
gcaggatccatggaagcgggacggcaagtggccgtggccaagcagattctcagcgctaag
aatgtgccttacctcgttgccgcccctctgctgattcaggatatttattcctggactcgc
caaggaataggtggcctgcaaagcgtggtgctctatgccctgccggaactcgatggcgca
attgatacgattcccctaggcgggctggttggtaatgacatttacattgtgcccgaacgg
gtcgatcgcctcaccggacggttgaagcaatggattgccctccgccagaaaccaatggca
gaaaggaagttagccattctcctctatggatttccgccgggatacggggcgactggaact
gcagcgctactgaatgtaccgaaatctctcttaagtctgctcagatccctaaaatcccaa
ggctataacgtgggagatttaccagaggatggcgaggaaatcgtcaactgggtgcgggaa
gcagataatggcttagttgatccagcccagatgaatggtcatgctggaaccacctccgtc
aatgtccgccagctggaaaggtggctgggatatttgctgacccatcggatagaaaagcag
tgggactccctaacgggaacaggaattaaaaccaatggcgaggaatttagcgtcggcggc
attcagatggggaatgtctggatcggggtgcagccacccctaggcttgtcgggtgatccg
atgcgcctaatgtttgagcgggatctaacgccccatccccaatacgcggccttctataaa
tggctgcaaaatggattccaggctgatggggtgatccattttggcatgcacggtaccgtg
gaatggctgcccggtagtcctctcggcaataccggctattcctggccggatgtattgctg
gggaatattccaaatctctatatctatgcggccaataatccctcggagtcgattttagcg
aaacgtcgaggctatggcgttttgatctcccataacgtccccccctatggtcgagctgag
ctatataaagagctagctgccttacgcgatctgattcaggaataccgtgaagacccggaa
aaaaatgcggtgctgcgggaggctatctgcaagaaaattattgatgcggggattgatgca
gattgtccgttccaagaagccaagcagttgggcattgaatttacccctgaaaatgctcgc
atgtttagtgctgaggccttcaaccactatctagtggagctatatgagtatctgcaagtt
ttagaaacgcggttattctcttccggtctgcatgtattgggcgaatctcctgatgctgag
aaactgggaagttaccttcaggcttattttggagaagagttaccagaagatgcgatcgca
gccgttgctacgggcgaagaatccgatcagattcgccagcgatttgaactcaatggcagt
acgcctaagctggaagaggccttgcaaatccgcagcctgctggcccaaacaggggatgaa
ctcactaacctactgcggggcttaaacggtgagtatgtgccgcctgcacccggtggagac
ttgctccgggatggtcccggcgttttacccacaggccgcaatatccacgcccttgacccc
tatcggatgccttctcctgctgcctatgagcggggtcgggagattgctcgtaagattttg
gcccagaacctggaagacaaaggcacctatccagaaactgtcgccgtaatgctttggggc
ttagatgccattaaaactcgcggggaatctatcggtattcttctagaactcgtaggggca
gaaccgattaaagaaggcacgggtcggattgttcgctatggtctgacgcctttagagcag
ctcgatcatccccgtgtagatgtcttggcgaacctgtccggcatattccgagatagcttt
gtcaatatcattgagctgttggacgatctatttttacgggcagcagaagccgatgagccc
ccggctcagaactttattcgtaaacatgccctggccttgaaagagcagggagtggagaat
gtctctgctcgtctcttttctaaccctgctggggatttcggctctttggtcaatgaccgt
gtgacggactccaactgggaatcttcagatgagttggggcaaacctggagcgatcggaat
gcctttagctatggccgcaatgacaaaggccaagcccgccctgaggtcctgcaaacctta
ctgaaaagtaccgagcagattgtccaagagattgactcagtggaatatggtttgactgat
attcaggaatattacgccaacaccggtggtctgaagttagcggcggagcagcagcggggc
agcaaggtcaaagccaattttgtcgagagtttctccaaggacaccaccccccgtgattta
gattcactactgcggatggaatatcggactaagctgctcaatcccaaatgggcagatgca
atggctgatcaaggctctggcggggcctatgagatttctcagcggatgacggccctgatt
ggctggggtggcactgctgatttccaagaagggtgggtctatgaccaagccgcagagacc
tatgccctagatcctgaaatggcggagaagttacgccaagctaatccagaagccttccgt
aatatcgtcggtcgcatgctagaggcccatggtcgtggattttggagtcctgaccaagac
atattggatcaactccgagcattgtatgaactgacggacgaggaactagaaggcattact
gcttag

DBGET integrated database retrieval system