KEGG   Acaryochloris marina: AM1_5034Help
Entry
AM1_5034          CDS       T00617                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amr  Acaryochloris marina
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5080585..5082816
Genome map
AA seq 743 aa AA seqDB search
MTYEAAHPTHPPTEQLQGVVERLTYHSDESGYTVARFKAPRTRELITIVGSFANIQAGQT
LQVQGIWRDHPKYGAQFQVKQYQETKPATLTGIEKYLGSGLIKGVGPVTAKRIVAHFGLE
TLDIIENQIERLVEVPGIAKKRVKLIQTAWDSQKTIKEVMVFLQGHGVSTTYAVKIFKQY
GDEAIDIVTQNPYRLATDVYGIGFITADQIARSLGIPPHSEYRYRSGLLHVLSESADEGH
CYLPQPELITRAVKRLALPEYQPKPDQVEYLIHAMVADAELIVEQFEREDATELLCYAPP
FFRAEFHLSRRLLQLLANPLEVDQGRVRRWLDRFMEQTNVHLSEQQQQAVELAASQRVVI
LTGGPGTGKTFTTRTIVALWKAMGKEIVLASPTGRAAQRLSEVTGHEAKTIHRLLEFDPK
TMKFQRDVDHPIPADAVVIDEASMLDLFLANSLIKAIDTNAQLLLVGDTDQLPSVGPGNV
LLDLITAQRIPVMELTEVFRQAQASQIIQNAHQINQGKFPHLESVSPAPKTDCLWLGAPE
PEQGQQAIQELINDLIPQLGYVAARDVQVLCPMTRGEVGTRKLNQVLQALINPPSPSKAE
LTRGGLILRVGDRVLQQVNDYNREVFNGDMGVIEAINLEEVAVTVRYAERSVSYDLADLN
EIGLAWAVTIHKSQGSEYPVVILPMYMQHYIMLSRNLLYTGLTRAKKLAILVGPKNAISM
AIRQVKDKQRYTLLDKRLSFVAQ
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgaggccgctcatccgactcatcccccgaccgaacagttacaaggggttgta
gagcggctaacctatcattccgatgaatcgggatataccgtggcccgcttcaaagcccct
agaacccgtgagttaatcaccattgtgggcagctttgctaatatccaagcgggccaaacc
ctccaagttcaggggatttggcgggatcatcctaaatacggcgctcaatttcaagtcaaa
caataccaagaaacgaaacccgctaccctgacggggattgaaaagtacctcgggagtggc
ttaattaagggcgtgggtccggtcaccgccaagcgcatcgtcgctcattttggcctagaa
accctggatattattgagaaccagattgagcgcctagttgaagtccccggcattgccaag
aagcgagtcaaactgattcagaccgcttgggacagccagaaaaccatcaaagaggtgatg
gtgttcctccagggccatggtgtctccactacctatgctgtcaaaatctttaagcagtat
ggagacgaagccatcgatatcgtcacccagaatccctaccgactggcaacggatgtctat
ggcattggctttatcactgccgatcaaattgcccgtagcttaggcattcctcctcactca
gagtatcgctatcgcagtggcctcctacatgtccttagcgagtccgccgatgaagggcat
tgttatctacctcaacctgagctgatcactcgggccgtaaagcgattggccctccccgaa
tatcagcccaagcccgatcaagtggaatatttgatccatgccatggtcgcggacgctgag
ctgattgttgaacagtttgaacgggaggatgcaacggaattgttgtgctatgctcctccc
ttctttcgagcggagtttcatttgtctcgccgattactccaattactcgccaatccccta
gaagtcgatcagggtcgagtccgtcgttggctcgatcggtttatggaacaaacgaatgtc
catctctcggagcaacagcagcaggctgtggagttggccgctagccagcgagttgtcatt
ctcacgggtggaccgggcacggggaagacctttaccacccggaccattgtcgccctctgg
aaagccatggggaaagagattgtattggcttctcccaccggacgagctgcccagcgactc
agcgaagtaacgggtcacgaagcgaaaaccatccatcgccttttagagtttgaccctaaa
accatgaagtttcagcgggatgtagaccaccccattcctgctgatgcggtggtgattgat
gaagcatccatgctggatttgtttctagccaattccctaattaaagccattgataccaat
gcccaactgttgctcgtgggggatacggatcagctacccagcgtcggacccggaaatgtg
ctgctggatctgattaccgcccagagaattcccgtcatggaactaacagaggtttttcgt
caagcccaagccagtcaaattatccaaaatgctcatcagattaaccaaggcaagttcccc
catctagagtctgtcagccctgcgcccaagacggattgtctctggcttggggcacctgag
ccggagcagggtcagcaagcgattcaagaactcatcaatgatctgattccgcaattggga
tatgtggcggcacgagatgtgcaggtcctttgtcctatgaccagaggagaggtggggact
cgcaagctgaatcaagttctgcaggcattgattaatccccctagtccgagtaaagctgag
ttaacccgaggggggctgattcttagggtgggcgatcgcgtacttcaacaggtcaatgat
tacaatcgcgaggtcttcaatggcgatatgggggtgatcgaggcgattaatctagaagag
gttgccgtgacggttcggtatgctgagcggtctgtttcttatgatctggcagacttaaat
gaaatagggttggcttgggccgtcacgattcataagagccaggggtcagaatatcccgtt
gtgatcctgcctatgtatatgcagcattacattatgctgagccgcaatctgctctacaca
ggtttgacgagggctaagaaactggcgattctagtgggtcccaaaaatgcaatcagcatg
gcgattcgacaggtgaaggataagcagcgatataccttgctggacaagcggttgagcttt
gttgctcagtga

DBGET integrated database retrieval system