KEGG   Acaryochloris marina: AM1_5497Help
Entry
AM1_5497          CDS       T00617                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amr  Acaryochloris marina
Pathway
amr00230  Purine metabolism
amr01100  Metabolic pathways
Module
amr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AM1_5497 (gmk)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AM1_5497 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA_18 RsgA_GTPase MMR_HSR1 cobW NTPase_1 ABC_tran AAA_5 T2SSE AAA_29 NACHT AAA_14 AAA_28 TsaE AAA_30 DAP3 AAA_25 Rad17 AAA_17 ATPase_2
Motif
Other DBs
NCBI-ProteinID: ABW30451
UniProt: B0CD09
Position
complement(5549160..5549717)
Genome map
AA seq 185 aa AA seqDB search
MTKTGKLIVLTGPSGVGKGTLLQQLLQACPDLYLAVSATTRSPREGEVDGKHYYFLTKDQ
FQTRIDQNQLLEWAEYAGNFYGTLRAPVMREITQGKKVILEIELVGARQIRDQVADAFQI
FVSPPSVADLEARIRGRGQDSEEAIARRLDQAKVELAAADEFDFQLVNDDLDAAFQTLKS
KVLSL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacgggtaagctgatcgtcctaactggacccagcggtgtcggcaaaggcact
cttttgcagcagctcttacaagcctgcccagatttataccttgcggtttccgccacgact
cgttctccccgagagggagaagtggatggcaaacactactactttttgaccaaagaccaa
tttcaaacccgcattgatcaaaatcagctcttggaatgggcagagtatgcaggtaatttc
tacggaacgctacgggctcccgtgatgcgggaaattacccaaggaaaaaaagtgattttg
gaaattgaactggttggggctcgtcaaatccgagatcaggttgccgatgcctttcaaatc
tttgtcagccccccttctgtggccgatttagaggctcggattcgggggcgaggccaggat
tcagaagaagccattgcccgccgtttagaccaggccaaggtcgagcttgccgccgccgat
gaatttgattttcagctggtcaatgatgatctagatgcagcctttcaaacccttaagtct
aaggtgttgtccctatga

DBGET integrated database retrieval system