KEGG   Acaryochloris marina: AM1_5564Help
Entry
AM1_5564          CDS       T00617                                 

Gene name
chlH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5616138..5620115
Genome map
AA seq 1325 aa AA seqDB search
MFTHVKSTIRHIVPKELRGRSLMKVVYVVLEPQYQSALTAAANAINSSHDSVAVELSGYL
LEELRSPENYEAFEADVAEANIFIGSLIFIEDLADKVVAAVEPHRDRLDVAVVFPSMPQV
MRLNKMGSFTMANLGQSQSAIAQFMRKRKEQSGASFQDGMLKLLRTLPKVLKYLPVDKAQ
DARNFMLSFQYWLGGSQDNLENFLLMLANKYVPELEDKVQFDDPVTYLEMGIWHPLAMEM
FADVKEYLNWFSSRRDIPDALKNGTAPTVGLILQRTHLVTGDDAHYVATVQELESLGARV
IPVFASGLDFSKPVEEFFYETPGGDKALVDAVVSLTGFALVGGPARQDHPKAVESLKKLN
RPYMVALPLVFQTTEEWEESDLGLHPIQAALQIAIPELDGAIEPIILSGRDGVTGRAIAL
QDRIEMVAQRAMKWASLRRKTKVEKKLAITVFSFPPDKGNVGSAAYLDVFNSIYKVMEAM
KKDGYTIEDMPENSEALMLEILHDAQAQYNSPELNIAHRMSVHEYESLTPYSKRLEESWG
PPPGQLNSDGQNLLVFGKTYGNLFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYYSYLE
KIFKADAVLHFGTHGSLEFMPGKQIGMSNDCYPDTLIGNIPNLYYYAANNPSEATIAKRR
SYANTISYLTPPAENAGLYKGLKELSDLIGSYQTLKESGRGIPIVNTIMDKARLVNLDQD
IDLPDQEAKDMTQEERDTIVGRVYIKLMEIESRLLPCGLHVIGKPPTAEEAIATLVNIAS
LDRGEDNILGLPRLIANSINRDLDEIFRNSDRGVLEDVDLLNTINETTRAAVAAIVQTQV
DEEGRVSTVSPLNLFNFGRQEEPWVKALNEAGFPNVDQEALTPLVEYLEFCLNQVVADNE
LGALLQALEGEYVLPGPGGDPIRNPDVLPTGKNIHALDPQSIPTEAAVQSAKVVVDRLLA
RQKQENNGEWPESIALVLWGTDNIKTYGESLAQVMWFVGVKPLPDSLGRVNKLELIPLEE
LGRPRVDVVVNCSGVFRDLFINQMALLDQAVKMAAEADEPLEMNFVRKHALKQAEDMGIN
LRQAATRIFSNASGSYAANVNLAVENSTWDEEAELQEMYLKRKSFAFSADSPGDMEQSRE
ILEASLKTVDATFQNLDSSEISLTDVSHYFDSDPTKVVSSLRDDKKKPNAYVADTTTANA
QVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVDNWVYE
DVNTTFIEDEEMRNRLKNLNPHSFRKVVSTLLEVNGRGYWETSEENLQMLRDLYQEVEDK
IEGVE
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgttcactcacgtcaagtccaccattagacatattgttcccaaggagttgcggggacgt
tccttaatgaaggtggtctatgtcgtgttagagcctcagtatcagagtgccctgacggca
gccgccaatgccatcaatagtagccatgacagtgtagccgtagaattaagcggctactta
ttagaagagctgcggtcacccgaaaattacgaagcttttgaagcagacgtggctgaagcc
aacatttttattggatctttgatctttatcgaagatttagccgataaagtcgttgctgcg
gtggaacctcatcgtgatcggttagatgtagcagtggttttcccctctatgcctcaagtg
atgcgcctcaacaagatgggcagcttcacaatggctaatttggggcaatcccaaagtgcg
atcgcacaatttatgcgcaagcgtaaagagcagtctggtgcctcgtttcaggacggcatg
ctgaagctgctgcgaactttacctaaagtgctcaagtatttacccgttgataaagcccag
gatgctcgcaactttatgctcagcttccagtactggctgggggggtcccaagacaacttg
gagaacttcctgctgatgttagccaacaagtatgtgccggagctggaggataaagtccag
tttgacgatccagtgacatatttggagatggggatttggcatcccttggccatggagatg
tttgccgatgtcaaagaatatctcaactggtttagctctcggcgtgatatccctgatgcg
ctcaagaatggcactgcacctaccgtcggcctgattctccagagaactcacttagtaacg
ggcgatgacgcccactatgtggcgacggttcaggaattggagtctttaggggctcgggta
attcccgtgtttgccagtggcttagacttttctaagcccgttgaagaatttttctatgaa
acccctggtggagataaagccttagtcgatgccgtagtttctctcactggatttgccctg
gtgggagggcctgctcgccaagatcaccccaaggcagtggaatccctgaagaagctaaac
cgtccttatatggtggccttgcccctagtcttccaaaccacggaagaatgggaagaaagt
gatttaggcttgcacccgattcaagctgctctacaaattgccattcctgaattggatggg
gcgattgagccgattattttgtcgggtcgtgatggtgttactggacgtgcgatcgcactg
caagaccggatcgagatggtggcccaacgagctatgaagtgggcttccttacgccggaag
actaaagttgagaagaaactagcaattacggttttcagcttcccaccggataaaggcaat
gtcggttccgctgcttacctggatgtgtttaactccatctacaaagtgatggaagccatg
aaaaaagatggctacaccatcgaagatatgcctgagaattctgaagcgttgatgctggag
atcctccatgacgcccaggctcagtacaacagccccgaactaaacattgcgcaccggatg
tcggtgcatgaatatgagtccctcaccccctactcaaaacgtctagaagagtcttggggg
ccccctcctggacagctcaatagcgatggccaaaatctcttggttttcggaaaaacttac
ggcaacctatttattggagttcagccgaccttcggttatgaaggtgaccccatgcgcttg
ctgttctcccgctccgctagcccccatcatggattcgccgcctactatagctatctagaa
aagatctttaaggcggatgccgttcttcactttggcacccatgggtctttggaatttatg
cccggtaaacagattggcatgtccaacgactgttatcccgataccttaatcggaaacatt
cccaacctttactactatgcggccaataatccatcagaagcgacgattgccaaacgccgc
agctatgccaacaccatcagctacctgaccccgccggcagaaaatgctggtctttataag
ggattaaaagagctcagcgacctgattggttcctatcaaaccctcaaagaaagtggtcga
ggcattcctatcgttaacacgattatggataaagctcgcctggtgaacttagatcaggac
attgacctgcctgatcaggaagccaaggacatgacccaagaggagcgcgacaccattgtc
ggccgggtttacatcaaactgatggaaattgagtcacggctcttaccctgtggactccat
gttattggtaagccccccactgcagaggaagccattgccaccctcgttaacattgccagc
ctggatcgcggtgaagacaatattttgggtctccctcgactgattgccaatagcatcaat
cgagacttagacgaaatattccgcaatagcgatcgcggtgttcttgaagatgttgatctc
ctcaacaccattaatgaaacgacgcgagctgccgttgctgcgattgtccaaactcaagtt
gatgaagaaggccgagtgtctacggtttctcctctaaatttatttaacttcggtcgccaa
gaagaaccttgggtaaaggccctgaatgaagcaggtttccccaatgtggatcaagaagcg
ctaacccccttggtggagtatctggagttctgtctcaatcaggtcgttgctgataatgaa
ctcggtgccttacttcaagccttagagggagaatatgtgctccctgggccaggcggtgac
ccgattcgtaacccagatgtgttgcccaccggcaaaaatatccatgctcttgaccctcaa
tccattcccacagaagcagcggtccaatccgctaaagttgtcgttgatcggcttttagcg
cgccaaaagcaagagaataatggcgaatggcctgaatctattgctctagtcctgtggggc
acagacaacatcaagacttatggcgaatctttggctcaagtcatgtggtttgtgggggta
aagccattaccagactccttaggtcgagtgaacaagctagaactcattcctttagaggaa
ttgggtcgacctcgcgttgatgtggtcgttaactgttccggtgtgttccgcgatctgttt
atcaaccagatggctctgttagaccaagctgttaagatggctgccgaagcggatgaacca
ttagagatgaactttgtccgcaagcatgcactcaagcaagccgaagatatgggcatcaat
ttgcgacaagctgccactcgaatcttctccaatgcctccggttcctatgccgctaacgtc
aacttggcggtggagaacagcacctgggatgaagaagctgaactgcaagagatgtacctc
aaacggaagtcctttgccttctctgctgattctcctggcgatatggagcagtccagagaa
attttggaagcctccctcaaaacagtagatgccaccttccaaaacctcgactcttctgaa
attagcctcacggacgtgagtcactattttgactctgatccaactaaggtcgtctccagc
cttcgggatgacaagaaaaagcccaatgcctatgttgctgataccacaacagccaatgct
caggtccgcaccctttcagaaacagtccgcttggatgctcgcaccaaactccttaacccg
aagtggtatgagggaatgctcagccacggttatgaaggtgtgcgtgagctatcaaaacgc
ctagtcaataccatgggctggtcagccacagcaggtgcagtggataattgggtttatgaa
gacgtgaacacaacctttatcgaagatgaggagatgcggaatcgtcttaagaatcttaat
cctcactctttccgcaaagtagtaagtacattacttgaggtgaatggccgtggatactgg
gaaacctctgaagagaacctacaaatgctccgagatctctatcaagaagttgaagacaag
attgaaggtgttgaatag

DBGET integrated database retrieval system