KEGG   Acaryochloris marina: AM1_5635Help
Entry
AM1_5635          CDS       T00617                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
amr  Acaryochloris marina
Pathway
amr00790  Folate biosynthesis
amr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AM1_5635 (folE)
Enzymes [BR:amr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AM1_5635 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF vATP-synt_E NARP1
Motif
Other DBs
NCBI-ProteinID: ABW30585
UniProt: B0CF69
Position
5695825..5696523
Genome map
AA seq 232 aa AA seqDB search
MTTFSPKPSDQANSSMNSTSNNAQLRPDRSLSQRAKEKETHRQASKEEMMGAVETMLLGV
GEDPEREGLLKTPKRVAEAMRFLTSGYQQSLEDLVNNAIFDEGHDEMVLVRDIDAFSLCE
HHMLPFIGKAHVAYIPNQKVIGLSKLARIVEMYSRRLQVQERLTRQIAEAVQTALEPKGV
AVVMEASHMCMVMRGVQKPGSWTVTSSMIGVFQDDHKTREEFLNLIRHPHNF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgactactttttctcctaaaccttctgatcaagccaattcttctatgaactcaacttct
aataacgctcagcttcgtcccgatcgcagcttatctcaacgggccaaggagaaagagacc
catcgtcaagccagcaaagaagagatgatgggagcggtagaaacgatgctgctaggggtt
ggtgaagatccagagcgggaaggtttactgaaaacaccgaagcgggtggctgaagccatg
cggtttctcacgagtggctatcagcagtccttagaagatttggtgaacaatgccattttt
gatgaaggccatgatgaaatggtcctcgttcgagatattgatgcctttagtttgtgtgag
catcatatgttgccctttatcggcaaagcccacgtggcatatatccctaatcaaaaggtg
attggtctgagtaagctggcccgtatcgtagaaatgtattctcgccggctgcaggtgcaa
gaaagattgactcgccaaattgcagaagcagtacaaacggctttagaaccgaagggtgtg
gctgtggttatggaagccagccatatgtgtatggtgatgcggggcgtacaaaaaccaggt
tcctggacggtgacgagttctatgatcggggtctttcaggacgatcataaaacccgagaa
gagttcttaaatctgattcggcatccccataatttctaa

DBGET integrated database retrieval system