KEGG   Acaryochloris marina: AM1_5764Help
Entry
AM1_5764          CDS       T00617                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
amr  Acaryochloris marina
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5844675..5846558
Genome map
AA seq 627 aa AA seqDB search
MCGIAGLIHINGDPVSPVILQHMTDAIAHRGPDGEGHWIEANVGLGHRRLAILDLSPAGH
QPMVSADHRFVLSYNGEIYNYQTLRAELETIGYWFRSKTDSEVVLYALAEWGVKAFDRLN
GMFALALWDRKTKSLLLARDRYGIKPLYYTQQGSLFTFGSEQKALLAIPGFERRLDKPAL
LEYFTFQNFFTDRTLLEGVRLLPAGHYAILDLGQSSPGLNIKQYWDYNFYEPAEPINEQD
YREELDRLFQQAVNRQLVSDVELGCYLSGGIDSGSISAIAARSYPYLKSFTCGFDLSSAS
GIELAFDERAQAEAMSYHFKTEHYEMVLKAGDMERVLPKLAWHLEEPRVGQSYPNYYAAQ
LASKFVKVVLSGAGGDELFGGYPWRYYRAVVNEDFENYIDKYYLFWHRLIPNSQLKKVFA
PIWNDVSQVWTRDIFRDVFQHHPDRLEGPKDYINHSLYFEAKTFLHGLLVVEDKLSMAHG
LESRVPFLDNDLVNFAMGCPVNLKLNNLAEVVRLNENDVGNKPQKFFQKTRDGKQIFRDV
MQKYISEDITKAEKQGFSAPDASWFKGDSIEFVKRKLLDPNAAIYSLVDRKAVQDLIEEH
LNGQKNRRLLIWSLLNVEEFIQQIGSL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatagcagggctgatccatattaatggtgatcccgtctctccggtgattttg
cagcacatgactgatgcgattgcccatcgtggccctgatggtgaagggcattggattgaa
gctaatgtgggtttgggccatcgccgtttagctatcttggatttgtctcctgcaggacat
cagccgatggtatcggcagatcaccgttttgtgctgagctataacggagagatttataac
tatcagacacttcgcgctgaattggagacgattggctactggtttcgttctaaaacagat
agtgaagtggttctctatgcattggcagaatggggagtaaaggcatttgatcggttaaac
ggaatgtttgccttggctctatgggaccgtaaaacgaaatcgcttttactcgcccgagat
cgctacggtattaaacctttatattacacacagcaaggtagtctgtttacgtttggatct
gagcaaaaagctttgctagcgatacccggatttgaacgtcgtctagataaaccagcacta
ctcgaatattttacgtttcagaatttttttacggatcgcaccttgcttgaaggggtcaga
ttactacctgcaggtcattatgccattttggatctggggcaaagttcacccggcctgaat
ataaagcagtactgggattataacttttatgaaccagcagagccgatcaatgagcaagat
tatagagaagaattagatcgactatttcaacaagctgtcaatcggcaattggtaagcgat
gttgagttaggatgctacctcagtggtgggatagattcaggttcaattagtgcgatcgca
gcccgttcctatccttatctaaaaagttttacctgtggttttgatctaagttcagcttct
gggattgagcttgcctttgacgagcgggctcaagcggaagcgatgtcttaccacttcaaa
acagagcattatgaaatggtgctcaaagcaggggatatggaacgggttctaccaaagcta
gcatggcatttagaagaacctcgggtaggacaaagttaccccaactattatgccgctcag
cttgcaagtaagtttgtaaaagtagttttaagtggtgcaggaggagatgagctttttgga
ggttatccctggcgctattaccgagcagtagtcaatgaagattttgaaaactatatcgat
aagtactacttgttttggcatcgcctaattcctaacagccaacttaagaaagtgtttgcg
cccatatggaatgatgtaagccaagtatggacacgtgacatttttcgtgatgtgtttcaa
catcacccagaccgtttagaaggaccaaaggattacattaaccactcgctatattttgaa
gcgaaaacgtttctacatggcctattagttgtggaagacaagctaagcatggctcatggc
ttagaaagccgtgtgccttttttagataatgatttagtcaattttgctatggggtgtcca
gtcaacttaaaactgaataatttggctgaggtggtgcgacttaatgaaaatgatgttggc
aacaaaccccaaaaattttttcagaaaactcgagatggtaaacagatattccgggatgtg
atgcagaaatatatctctgaagacattactaaggctgagaagcaaggattttctgctcca
gatgcaagttggttcaaaggtgacagtattgagtttgtgaaacggaaattattagaccca
aatgctgcaatttattcactagtagatagaaaggcagtgcaggatttgattgaagaacac
ttaaatggacaaaaaaatcgccgtctactaatttggtctttgctgaatgtagaagaattc
attcagcagataggtagtttgtaa

DBGET integrated database retrieval system