KEGG   Acaryochloris marina: AM1_5767Help
Entry
AM1_5767          CDS       T00617                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_5767
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AM1_5767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5848278..5849654
Genome map
AA seq 458 aa AA seqDB search
MNFAIVGGGITGLIAAKILNDKYPNSNITLIEKANEMGGILAGTYYKKQGIYFDKGTHIF
RETGYPQIDDFILSSIPKTELIHFDVHQGDIAGAVFDGKLQSNSHFPDIRKLTNYDDLYI
SLSNQVNSCNPISPIERLEPLITNACSRFGELYTKKVLAPILSNLFQRPAEDLASFSLLL
PGLTRIVCSNYLEWLQNAHNIQYREIFAVPDQRKLPNQLRHGKRSFYSHSLGSRNFVKGI
TANLESKGVQFLQSTTITSFNLDKLLITCLTPKGESLELQVDGIVLATGVFGAAQLLDIS
MEIFSFDQPILSRIINLIVKKSPESDLCYFYGLDPKMDFYRVTNYRAFSGNPKDRRLSIE
VLGNNAIDNSILPQHVLKQLFDIGFISHEGFEFGDVVRLKTGFPTPTISNMQSLVKLSDY
VHEQLPNKVLLGGIGAKKGLFFQNEIIKDISDKILERF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgccatcgttgggggagggataactggcttaattgcagctaaaattctaaat
gataaataccctaatagtaacattacgctcattgaaaaagctaatgagatgggtggaatt
ctggctggaacctattataaaaaacaaggaatctactttgataagggaactcatatattt
cgtgaaacaggttatcctcagattgatgactttatattgagctctattccgaaaactgaa
cttatccattttgatgttcatcaaggtgatattgctggggcagtttttgatggaaagtta
caatcgaattcccatttccctgatattcgtaaactcactaattatgatgatctttatata
tctttaagcaatcaggttaattcctgtaaccctatttctcctatagagagactagaacct
ttaataactaatgcttgttctcgttttggagaactatacactaaaaaggttttagctcct
atactgtcaaatttatttcagagaccagccgaagacttggctagtttttctctgttacta
ccaggacttacacgaatcgtctgttcaaattatcttgagtggttgcagaatgcccataac
atccaatatcgtgaaatatttgctgtaccagatcagcgtaagctaccaaatcaattacgc
catgggaaaagaagtttctattctcatagccttggctcaagaaatttcgtgaaaggtatt
actgctaatcttgagtctaaaggtgttcagtttttgcaaagcacaaccattacatcattt
aatcttgataaattactcataacttgtcttacgccgaaaggtgagtcattagagctccaa
gtggatggaatagtgcttgcaacaggtgtatttggtgctgcccaattattagatatctca
atggagatctttagttttgatcaaccaatacttagtcgaattataaatctcattgttaag
aaatctccagagagcgatctttgttatttttatggtcttgatccgaagatggatttctat
agggtgacgaactatcgagctttttcgggaaatccaaaagatcgtcgtttatctattgag
gtactaggtaataatgctattgataattcaatacttccacaacatgttcttaaacagctt
tttgatattggatttatatcacatgaagggtttgaatttggcgatgttgttagactaaaa
actggttttcctactcctacaattagtaatatgcagtccttggttaaattgagtgattat
gtccatgagcaattaccaaataaggtattattgggcggaattggagccaagaaaggctta
ttttttcaaaatgagatcatcaaagatatttccgataaaattttagaacgattttaa

DBGET integrated database retrieval system