KEGG   Acaryochloris marina: AM1_B0356Help
Entry
AM1_B0356         CDS       T00617                                 

Definition
tyrosinase, putative
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
amr  Acaryochloris marina
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AM1_B0356
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AM1_B0356
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AM1_B0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pREB2:complement(297202..298668)
Genome map
AA seq 488 aa AA seqDB search
MFTSKTRREFLISAGAATALFFLPTKVAQAQELRTRKNVASPDAEGDLASLRDGVSEMKR
LINTDPEDPRGWILQAYIHGNCNDFTDCKHSNWYFAPWHRSYLYYFEQLIQHFSGNATFA
LPYWDWSQTHTVPSSFYGDANPLDDNISIQSICSSAPTAGRGRPDGEEITQQELEEYVGP
VRIESIQQNPDYATYGGIGGSGELEVIPHNFIHRWVGDVGGKNSNMVQFFSPLDPIFWMH
HCNIDRLYSDWLSRPGHLPPSEDEWQNQSFNEFYDVDKNQVGSEFTCGQTVDSRVMGYVY
STDQITNLTQTLAARSSIIRQQVVESVIESKSILVENVLSFEANVDLSLRTRRLISTAAV
GVPNYVVRLRIEGVKTPKQQNTGVFVFLGPDITAETPISAPGYVGNFTFFEGQGGGNRKR
WSHGHKKNVLLNATEAVKRLYGDTRLSESNSLKVSIVTRSLFGDQNAFASVEEIQPNMVQ
IDVVDLNA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttctaaaacacgtcgtgagttcctgatctctgctggtgcagctacggctttg
ttctttcttcccaccaaggtagcgcaagcacaggaactgcgcacgcgaaagaatgttgct
agccctgatgcagaaggcgatcttgcctctttgcgcgatggagtgagcgagatgaagagg
ctgataaatacagatcctgaagacccacgaggatggattctccaagcttatattcatggt
aactgtaatgattttaccgattgtaagcatagtaattggtactttgcaccctggcatcgc
tcttatctctactatttcgagcaactcatccaacacttcagcggtaacgctacctttgca
ctgccatattgggattggtcacaaacccatactgtaccgagttcgttctatggcgatgcc
aatcctctcgacgataatatttcgatccagtctatttgttcttcagcaccaacggcaggt
cgtggccgtcccgacggagaggagattacacaacaagaattagaagagtatgttggtccc
gttaggatcgagagcatccagcagaatcccgactatgcaacctatggaggtattggaggt
agtggtgaactagaggtaatcccacacaacttcatccatcgatgggttggtgatgtcggt
gggaagaatagcaatatggtgcagtttttttctcctctggatccaatattctggatgcat
cactgcaacatagaccgcctttactctgattggctttctagaccaggccacttacctcct
tcagaagatgagtggcagaaccaatcctttaacgaattctatgatgttgataaaaaccag
gtcgggagtgaattcacgtgtggtcagactgtggactcaagggttatgggctatgtctac
agtaccgatcagattactaacctaacacagacgttggcagcacgatcaagcataataagg
cagcaggttgtagaatctgtaattgagtcgaagtctatccttgtggaaaatgtgctttca
tttgaagctaatgtggatttatctctacggactcgtcgtcttataagtacggcagcagtc
ggagtacctaactatgttgtacgtctgcgtattgaaggtgtcaagacaccaaagcagcaa
aatactggtgtttttgtatttttagggcctgacattactgctgaaactcctatatctgca
ccgggatatgtcggcaacttcaccttctttgagggacaaggtggcggcaacagaaagcgt
tggagtcatggtcacaagaagaatgtacttcttaatgctactgaagctgtcaagagactc
tatggagacactcgcttgtcagagagcaatagcctgaaagtttcgattgtgactcgctcc
ctttttggtgaccagaatgccttcgcatcggtggaggaaatccaaccaaatatggttcag
attgatgtggttgacctcaatgcttga

DBGET integrated database retrieval system