KEGG   Acaryochloris marina: AM1_B0356Help
Entry
AM1_B0356         CDS       T00617                                 

Definition
tyrosinase, putative
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
amr  Acaryochloris marina
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:amr00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:amr00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pREB2:complement(297202..298668)
Genome map
AA seq 488 aa AA seqDB search
MFTSKTRREFLISAGAATALFFLPTKVAQAQELRTRKNVASPDAEGDLASLRDGVSEMKR
LINTDPEDPRGWILQAYIHGNCNDFTDCKHSNWYFAPWHRSYLYYFEQLIQHFSGNATFA
LPYWDWSQTHTVPSSFYGDANPLDDNISIQSICSSAPTAGRGRPDGEEITQQELEEYVGP
VRIESIQQNPDYATYGGIGGSGELEVIPHNFIHRWVGDVGGKNSNMVQFFSPLDPIFWMH
HCNIDRLYSDWLSRPGHLPPSEDEWQNQSFNEFYDVDKNQVGSEFTCGQTVDSRVMGYVY
STDQITNLTQTLAARSSIIRQQVVESVIESKSILVENVLSFEANVDLSLRTRRLISTAAV
GVPNYVVRLRIEGVKTPKQQNTGVFVFLGPDITAETPISAPGYVGNFTFFEGQGGGNRKR
WSHGHKKNVLLNATEAVKRLYGDTRLSESNSLKVSIVTRSLFGDQNAFASVEEIQPNMVQ
IDVVDLNA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttctaaaacacgtcgtgagttcctgatctctgctggtgcagctacggctttg
ttctttcttcccaccaaggtagcgcaagcacaggaactgcgcacgcgaaagaatgttgct
agccctgatgcagaaggcgatcttgcctctttgcgcgatggagtgagcgagatgaagagg
ctgataaatacagatcctgaagacccacgaggatggattctccaagcttatattcatggt
aactgtaatgattttaccgattgtaagcatagtaattggtactttgcaccctggcatcgc
tcttatctctactatttcgagcaactcatccaacacttcagcggtaacgctacctttgca
ctgccatattgggattggtcacaaacccatactgtaccgagttcgttctatggcgatgcc
aatcctctcgacgataatatttcgatccagtctatttgttcttcagcaccaacggcaggt
cgtggccgtcccgacggagaggagattacacaacaagaattagaagagtatgttggtccc
gttaggatcgagagcatccagcagaatcccgactatgcaacctatggaggtattggaggt
agtggtgaactagaggtaatcccacacaacttcatccatcgatgggttggtgatgtcggt
gggaagaatagcaatatggtgcagtttttttctcctctggatccaatattctggatgcat
cactgcaacatagaccgcctttactctgattggctttctagaccaggccacttacctcct
tcagaagatgagtggcagaaccaatcctttaacgaattctatgatgttgataaaaaccag
gtcgggagtgaattcacgtgtggtcagactgtggactcaagggttatgggctatgtctac
agtaccgatcagattactaacctaacacagacgttggcagcacgatcaagcataataagg
cagcaggttgtagaatctgtaattgagtcgaagtctatccttgtggaaaatgtgctttca
tttgaagctaatgtggatttatctctacggactcgtcgtcttataagtacggcagcagtc
ggagtacctaactatgttgtacgtctgcgtattgaaggtgtcaagacaccaaagcagcaa
aatactggtgtttttgtatttttagggcctgacattactgctgaaactcctatatctgca
ccgggatatgtcggcaacttcaccttctttgagggacaaggtggcggcaacagaaagcgt
tggagtcatggtcacaagaagaatgtacttcttaatgctactgaagctgtcaagagactc
tatggagacactcgcttgtcagagagcaatagcctgaaagtttcgattgtgactcgctcc
ctttttggtgaccagaatgccttcgcatcggtggaggaaatccaaccaaatatggttcag
attgatgtggttgacctcaatgcttga

DBGET integrated database retrieval system