KEGG   Acaryochloris marina: AM1_E0093Help
Entry
AM1_E0093         CDS       T00617                                 

Definition
esterase/lipase, putative
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
amr  Acaryochloris marina
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pREB5:complement(64765..65571)
Genome map
AA seq 268 aa AA seqDB search
MHQPSYFSGFDLLSSDIEKLLMPDAKPQFCKAKPNGDAVVICVHGFTGNPYDVSPAISTL
SNMGLSVVAPLLPGHGYRERHKQEQAFSNITPEGMLSAARQEIARAREHYSKVGMFGFSM
GGAISLTMASEGLIDACAVAAPALRLSRKAEILIPLLSWASFSIEAPPQEPFYLPVYEFY
HSKALRTLWQLSGYARRRLSHIQCPVFAVHSHKDLMVPPIVLGMMQENIPFEIETAWFDE
SGHSMLLDVSGPRVSSAIASFFQRQFLH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagccatcatatttctcaggatttgaccttctctcatcagatattgaaaaactg
ttgatgcctgacgcaaagcctcagttctgcaaggccaagcctaatggtgatgcagtggtt
atatgcgtgcatggctttaccggaaatccttatgatgtgtctccagcaatctctacactc
tcaaacatgggtttatccgtagtagcccccttattaccagggcatggctatcgagagcga
cataaacaagagcaagcattctctaacatcacaccggaagggatgctctccgcagctcga
caagaaattgctcgggcaagggagcattattctaaggtcggtatgttcggattttcaatg
ggcggtgcgatctcgctaactatggcttccgaaggattgatagatgcctgtgccgtagct
gcaccagccttacgattatctcgaaaagccgagattttgattccgcttttaagctgggca
agcttttccatagaagctccacctcaagaaccattttatttacccgtctatgagttttat
cactccaaagctttgagaacactctggcaactaagtggctatgctcgtcgtaggttatcc
catattcaatgtcctgtatttgcagtccattcccataaagatttaatggtgccgcctatt
gtgctaggaatgatgcaagaaaacattccatttgagattgaaactgcttggtttgatgag
tctgggcactcgatgctactagatgtgagtggaccaagagtatcttcagctattgctagt
ttttttcaacgtcagttcttgcactaa

DBGET integrated database retrieval system