KEGG   Actinoplanes missouriensis: AMIS_10350Help
Entry
AMIS_10350        CDS       T01795                                 

Gene name
xylA
Definition
putative xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ams  Actinoplanes missouriensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMIS_10350 (xylA)
   00051 Fructose and mannose metabolism
    AMIS_10350 (xylA)
Enzymes [BR:ams01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AMIS_10350 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1107410..1108594
Genome map
AA seq 394 aa AA seqDB search
MSVQATREDKFSFGLWTVGWQARDAFGDATRTALDPVEAVHKLAEIGAYGITFHDDDLVP
FGSDAQTRDGIIAGFKKALDETGLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVL
RQMDLGAELGAKTLVLWGGREGAEYDSAKDVSAALDRYREALNLLAQYSEDRGYGLRFAI
EPKPNEPRGDILLPTAGHAIAFVQELERPELFGINPETGHEQMSNLNFTQGIAQALWHKK
LFHIDLNGQHGPKFDQDLVFGHGDLLNAFSLVDLLENGPDGAPAYDGPRHFDYKPSRTED
YDGVWESAKANIRMYLLLKERAKAFRADPEVQEALAASKVAELKTPTLNPGEGYAELLAD
RSAFEDYDADAVGAKGFGFVKLNQLAIEHLLGAR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtccaggccacacgcgaagacaagttctccttcggtctctggaccgttggatgg
caggctcgtgacgcgttcggtgacgccacgcgtacggcactcgacccggtcgaggccgtg
cacaagctcgctgagatcggcgcctacggcatcacgttccacgacgacgacctggtgccc
ttcggctcggacgcccagacccgcgacggcatcatcgcgggcttcaagaaggcgctcgac
gagaccggcctgatcgtcccgatggtgaccaccaacctcttcacccacccggtgttcaag
gacggcggcttcaccagcaacgaccgttccgtgcggcgctacgcgatccgcaaggtgctg
cgccagatggacctcggcgccgagctgggcgcgaagacgctcgtcctctggggcggccgc
gagggcgccgagtacgactcggccaaggacgtcagcgccgccctcgaccgctaccgcgag
gcgctcaacctgctcgcgcagtactccgaggaccgcggttacggcctgcgcttcgccatc
gagccgaagccgaacgagccccgcggcgacatcctgctcccgaccgccggccacgccatc
gcgttcgtgcaggagctggagcgtcccgagctcttcggcatcaacccggagaccgggcac
gagcagatgtcgaacctcaacttcacccagggcatcgcccaggcgctgtggcacaagaag
ctgttccacatcgacctgaacggtcagcacggcccgaagttcgaccaggacctggtcttc
ggccacggtgacctgctcaacgcgttctcgctggtcgacctcctggagaacggcccggac
ggcgccccggcgtacgacggaccccgtcacttcgactacaagccgtcccgtaccgaggac
tacgacggcgtctgggagtcggcgaaggccaacatccggatgtacctgctgctcaaggag
cgggccaaggcgttccgcgccgaccccgaggtgcaggaggcgctcgccgccagcaaggtc
gcggagctgaagaccccgaccctgaacccgggcgagggatacgccgagctgctcgccgac
cgcagcgcgttcgaggactacgacgccgacgccgtgggcgccaagggcttcggcttcgtc
aagctgaaccagctcgcgatcgagcacctgctcggagcccgctga

DBGET integrated database retrieval system