KEGG   Actinoplanes missouriensis: AMIS_13050Help
Entry
AMIS_13050        CDS       T01795                                 

Definition
putative beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ams  Actinoplanes missouriensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_13050
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    AMIS_13050
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMIS_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1388678..1390294
Genome map
AA seq 538 aa AA seqDB search
MQAQPSASAGLVINADPAARAAEVVTRLSDEDLAGQVLMPYAYGSYATSVDKGAQAGNQQ
LAGVNTPAEMIEKFKLGGLILVGFTPDDPTGDTNPTTNVENPKQVRELTRGLQQAALKLP
AAAPLMIGTDQEYGVVTRITEGVTMLPSAMAAGAAGQPSLTEVAWRAAGEELAAMGITVD
FAPVADTIMPKGGGLIGSRSFGSDAKANAAQVTAAVRGLQGAGVTAALKHFPGHGHTSGD
SHDELPVIKQSRKAWETQDLPPFRSGVEAGAGIVMSGHLDLEAVDKGTAATFSHKIMTDV
LRKDLKFTGVAISDAMNMAPAKKWPSGEAAVRALNAGNDMLLMPPDIAGARDGILAGLKS
GSLKRERLVEAVTRILTLKFRTEIRNQPDLEVVGSSAHARSVGALDAASITVLRGKCSGP
LVNGAVTVTAPASRELARVTMVRALQESGVKVQADGGAKIRLVGYGDTAVDLDDSAAITV
MMDMPSLLSLSRSPTLIATYSSSKLSLTALAAVIAGKAKAPGKSPIEVTGLKRSACVK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcagccgtcggccagcgccggtctggtgatcaatgccgacccggccgcccgg
gccgccgaggtggtgacccggctcagcgacgaggacctcgccgggcaggtgctgatgccg
tatgcctacggcagttacgccacctccgtcgacaagggcgcccaggccggcaaccagcag
ctggccggcgtgaacacccctgccgagatgatcgagaagttcaagctgggcggcctgatc
ctggtcggtttcaccccggacgacccgaccggcgacaccaacccgaccacgaacgtggag
aaccccaagcaggtccgcgagctcacccgcggcctgcagcaggcggcgctgaaactgccc
gccgctgcgcccttgatgatcggcaccgaccaggagtacggcgtggtcacccggatcacc
gagggcgtcaccatgctgccgtcggcgatggccgcgggcgccgccggccagcccagcctc
accgaggtggcatggcgcgcggccggcgaggagctggccgcgatggggatcaccgtcgac
ttcgcaccggtcgccgacacgatcatgccgaaaggcggcgggctgatcggctcccgctcg
ttcggctcggacgccaaggcgaacgccgcccaggtcaccgccgcggtgcgcggcctgcag
ggcgccggcgtcacggccgccctcaagcacttcccggggcacgggcacaccagcggggac
agccacgacgagctgccggtgatcaagcagagccgcaaggcgtgggagacgcaggacctg
ccgccgttccggtccggcgtcgaggcgggggccggcatcgtgatgtccggccacctcgac
ctggaggcggtcgacaagggcacggccgccaccttctcccacaagatcatgaccgacgtc
ctgcgcaaggacctcaagttcaccggggtcgcgatcagcgacgcgatgaacatggcgccg
gcgaagaagtggccgtccggcgaggccgcggtccgcgcgctcaacgcgggcaacgacatg
ctgctgatgccgccggacatcgcgggcgcccgggacggcatcctggccggtctgaaaagc
ggcagcctcaagcgggaacgactggtcgaggcggtcacccggatcctcaccctgaagttc
cgcaccgagatccggaaccagccggacctcgaggtggtcggctcgtccgcgcacgcccgc
tcggtcggcgcgctggacgccgcctcgatcaccgtcctccgcggcaagtgctccggcccg
ctggtcaacggcgctgtcacggtcaccgccccggcgtcgcgcgagctggcccgggtcacc
atggtccgcgccctgcaggagtcgggcgtgaaggtgcaggccgacggcggtgcgaagatc
cgcctggtcggctacggggacaccgccgtcgacctggacgactccgccgcgatcacggtg
atgatggacatgccgtcgctgctcagcctgtcccgctcgccgacgctgatcgccacgtac
tcgtcgagcaagctctcgctgaccgcgctcgccgcggtgatcgcgggcaaggcgaaggcg
cccggcaagtcgccgatcgaggtgaccggcctgaagcgcagcgcctgcgtgaagtaa

DBGET integrated database retrieval system