KEGG   Actinoplanes missouriensis: AMIS_13050Help
Entry
AMIS_13050        CDS       T01795                                 

Definition
putative beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ams  Actinoplanes missouriensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ams00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ams00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1388678..1390294
Genome map
AA seq 538 aa AA seqDB search
MQAQPSASAGLVINADPAARAAEVVTRLSDEDLAGQVLMPYAYGSYATSVDKGAQAGNQQ
LAGVNTPAEMIEKFKLGGLILVGFTPDDPTGDTNPTTNVENPKQVRELTRGLQQAALKLP
AAAPLMIGTDQEYGVVTRITEGVTMLPSAMAAGAAGQPSLTEVAWRAAGEELAAMGITVD
FAPVADTIMPKGGGLIGSRSFGSDAKANAAQVTAAVRGLQGAGVTAALKHFPGHGHTSGD
SHDELPVIKQSRKAWETQDLPPFRSGVEAGAGIVMSGHLDLEAVDKGTAATFSHKIMTDV
LRKDLKFTGVAISDAMNMAPAKKWPSGEAAVRALNAGNDMLLMPPDIAGARDGILAGLKS
GSLKRERLVEAVTRILTLKFRTEIRNQPDLEVVGSSAHARSVGALDAASITVLRGKCSGP
LVNGAVTVTAPASRELARVTMVRALQESGVKVQADGGAKIRLVGYGDTAVDLDDSAAITV
MMDMPSLLSLSRSPTLIATYSSSKLSLTALAAVIAGKAKAPGKSPIEVTGLKRSACVK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcagccgtcggccagcgccggtctggtgatcaatgccgacccggccgcccgg
gccgccgaggtggtgacccggctcagcgacgaggacctcgccgggcaggtgctgatgccg
tatgcctacggcagttacgccacctccgtcgacaagggcgcccaggccggcaaccagcag
ctggccggcgtgaacacccctgccgagatgatcgagaagttcaagctgggcggcctgatc
ctggtcggtttcaccccggacgacccgaccggcgacaccaacccgaccacgaacgtggag
aaccccaagcaggtccgcgagctcacccgcggcctgcagcaggcggcgctgaaactgccc
gccgctgcgcccttgatgatcggcaccgaccaggagtacggcgtggtcacccggatcacc
gagggcgtcaccatgctgccgtcggcgatggccgcgggcgccgccggccagcccagcctc
accgaggtggcatggcgcgcggccggcgaggagctggccgcgatggggatcaccgtcgac
ttcgcaccggtcgccgacacgatcatgccgaaaggcggcgggctgatcggctcccgctcg
ttcggctcggacgccaaggcgaacgccgcccaggtcaccgccgcggtgcgcggcctgcag
ggcgccggcgtcacggccgccctcaagcacttcccggggcacgggcacaccagcggggac
agccacgacgagctgccggtgatcaagcagagccgcaaggcgtgggagacgcaggacctg
ccgccgttccggtccggcgtcgaggcgggggccggcatcgtgatgtccggccacctcgac
ctggaggcggtcgacaagggcacggccgccaccttctcccacaagatcatgaccgacgtc
ctgcgcaaggacctcaagttcaccggggtcgcgatcagcgacgcgatgaacatggcgccg
gcgaagaagtggccgtccggcgaggccgcggtccgcgcgctcaacgcgggcaacgacatg
ctgctgatgccgccggacatcgcgggcgcccgggacggcatcctggccggtctgaaaagc
ggcagcctcaagcgggaacgactggtcgaggcggtcacccggatcctcaccctgaagttc
cgcaccgagatccggaaccagccggacctcgaggtggtcggctcgtccgcgcacgcccgc
tcggtcggcgcgctggacgccgcctcgatcaccgtcctccgcggcaagtgctccggcccg
ctggtcaacggcgctgtcacggtcaccgccccggcgtcgcgcgagctggcccgggtcacc
atggtccgcgccctgcaggagtcgggcgtgaaggtgcaggccgacggcggtgcgaagatc
cgcctggtcggctacggggacaccgccgtcgacctggacgactccgccgcgatcacggtg
atgatggacatgccgtcgctgctcagcctgtcccgctcgccgacgctgatcgccacgtac
tcgtcgagcaagctctcgctgaccgcgctcgccgcggtgatcgcgggcaaggcgaaggcg
cccggcaagtcgccgatcgaggtgaccggcctgaagcgcagcgcctgcgtgaagtaa

DBGET integrated database retrieval system