KEGG   Actinoplanes missouriensis: AMIS_13880Help
Entry
AMIS_13880        CDS       T01795                                 

Definition
putative dihydrolipoamide S-succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ams  Actinoplanes missouriensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_13880
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMIS_13880
  Amino acid metabolism
   00310 Lysine degradation
    AMIS_13880
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMIS_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1489031..1490866)
Genome map
AA seq 611 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGERVEADEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELAVIAGEGEDAGSAAPAPAQQQAAEPEPEPEPAALTTPSTEKPVEEET
PAPQTASAGSSEGTEVKLPALGESVTEGTVTRWLKQVGETVEADEPLLEVSTDKVDTEIP
SPVAGTVLEIKVGEDETAEVGAVLAVIGSADAAPAKQETPPPAPKQEAPKQEAPKQESAP
APQPRIESAPAPQIGESYATPSPAAETKQPAAPAQPAAPAQPAAPAAETVKSNGAGDAGY
VTPLVRKLAAEKGVDLSTLSGTGVGGRIRKQDVLDAAEKAAAAKAAPAPAADASAPAAAA
AKPAAKAEPSPLRGRTEKLTRIRATIARRMVESLQISAQLTTVVEVDVTKIANLRNKAKA
DFQAKHGVKLTFLPFFALATVEALQQHPVVNSSIDVEAGTVTYHGAEHLGIAVDAPKGLV
VPVIKDAGDLNLGGLAKRIADVAERTRNNKIGPDELGGGTFTLTNTGSRGALFDTPIINQ
PQVGILGLGAVVKRPVIVNDPELGEIIAPRSMVYLALSYDHRIVDGADAARFLGTLKERL
EGGHFEADLGL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtaaccatgccgcggctgggagagagtgtcaccgagggcaccgtcacc
cgctggctcaagcaggagggcgagcgggtcgaggcggacgagccgctgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgcagcgggcgtgctgacccggatcgtg
gtgggcgaggacgagaccgcggaggtcggcagcgagctggccgtcatcgccggtgagggc
gaggacgccggttccgccgcgcccgcgcccgcgcagcagcaggctgccgagccggagccg
gagccggagcccgccgcgctgaccacgccgtcgaccgagaagccggtcgaggaggagacc
ccggcgccgcagaccgcgtccgccggcagctccgagggcacggaggtcaagcttccggcg
ctcggcgagagcgtcaccgagggcaccgtcacgcgctggctcaagcaggtcggcgagacg
gtcgaggccgacgagccgctcctcgaggtctccaccgacaaggtcgacaccgagatcccg
tcgccggtcgccggcacggttctcgagatcaaggtcggcgaggacgagaccgccgaggtc
ggcgccgtgctcgcggtgatcgggtcggcggacgccgccccggccaagcaggagaccccg
ccgcccgcgcccaagcaggaggctccgaagcaggaggctcccaagcaggagtcggcgccg
gctccgcagccgcggatcgagtcggcccccgcgccgcagatcggcgagtcctacgccacc
ccgtcgccggctgccgagaccaagcagcccgccgccccggcccagcccgccgccccggcc
cagccggccgctccggccgccgagacggtcaagtcgaacggcgccggcgacgccggttac
gtgacgccgctggtccgcaagctggccgccgagaagggcgtggacctgtccacgctgtcc
ggcaccggcgtcggtggccggatccgcaagcaggacgtgctggacgcggcggagaaggct
gccgcggccaaggcggccccggcccccgcagcagatgcgtccgccccggcggcggccgct
gccaagcccgccgccaaggcggagccgagcccgctgcggggccgcaccgagaagctcacc
cgcatccgggccaccatcgcccggcgcatggtggagtcgctgcagatctcggcgcagctc
accacggtggtcgaggtggacgtcaccaagatcgccaacctgcgcaacaaggcgaaggcc
gacttccaggccaagcacggcgtgaagctcaccttcctgccgttcttcgccctggccacg
gtcgaggcgctgcagcagcacccggtggtcaactcctcgatcgacgtcgaggcgggcacg
gtcacctaccacggcgccgagcacctgggcatcgcggtggacgcgccgaagggcctggtc
gtcccggtcatcaaggacgccggcgacctgaacctgggtggcctcgccaagcgcatcgcg
gacgtcgcggagcggacccggaacaacaagatcggaccggacgagctgggcggcggcacg
ttcacgctgaccaacaccggcagccggggcgcgctcttcgacaccccgatcatcaaccag
ccgcaggtcggcatcctcggtctcggcgcggtcgtcaagcgcccggtgatcgtgaacgac
ccggagctgggcgagatcatcgcgccgcgctcgatggtctacctggcgctcagctacgac
caccggatcgtggacggcgctgacgcggcccgcttcctgggcacgctgaaggagcggctg
gagggcggccacttcgaggccgacctcgggctgtga

DBGET integrated database retrieval system