KEGG   Actinoplanes missouriensis: AMIS_14580Help
Entry
AMIS_14580        CDS       T01795                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_14580
   01230 Biosynthesis of amino acids
    AMIS_14580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_14580
   00030 Pentose phosphate pathway
    AMIS_14580
   00051 Fructose and mannose metabolism
    AMIS_14580
   00052 Galactose metabolism
    AMIS_14580
  Energy metabolism
   00680 Methane metabolism
    AMIS_14580
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AMIS_14580
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AMIS_14580
Protein phosphatases and associated proteins [BR:ams01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AMIS_14580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1563169..1564197
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVTAYGHEFVGFRDGWKGPLEGLTKPLGIAEVRGI
LPRGGTILGSSRTNPFKIEGGVEKIKANLAEQGVDALVAIGGEDTLGVATKLHDLGVNVV
GVPKTIDNDLNGTDYTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERKFDVEQVATYVTKRFQVEYAPIVVVAEGAQPLDGQMVLHNQELDSF
GHVRLGGIGQWLAEQIEEKTGKEARTVVLGHIQRGGTPTAFDRVLSTRFGLQAIDAVNDG
DFGKMVALRGTDIVRIPLIEGTGELKTVPLERYEEAEVFFGN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctgaccggtggcggcgactgccccggcctcaacgcggtcatccgg
gccgtcgtccgtaagggcgtcaccgcttacggccacgagttcgttggcttccgtgacgga
tggaagggcccgctggagggtctcaccaagccgctgggtatcgcggaggtgcgtggcatc
ctgccgcgcggtggcacgatcctcggctcctcgcgcaccaacccgttcaagatcgagggt
ggcgtcgagaagatcaaggccaacctggccgagcagggcgtggacgcgctcgtcgcgatc
ggcggcgaggacaccctcggtgtcgccaccaagctgcacgacctgggcgtgaacgtcgtc
ggcgtgccgaagacgatcgacaacgacctcaacggcaccgactacacgttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccggctgcacaccaccgccgagtcgcac
caccgcaccctggtcgtcgaggtcatgggccggcacgccggctggatcgccctgcacgcc
ggtctcgccggtggcgccaacgtgatcctgctgccggagcgcaagttcgacgtggagcag
gtcgcgacgtacgtgaccaagcgcttccaggtcgagtacgcgccgatcgtcgtggtcgcc
gagggcgcgcagccgctcgacggccagatggtgctgcacaaccaggagctggacagcttc
ggtcacgtccgtctgggcggcatcggccagtggctcgccgagcagatcgaggagaagacc
ggcaaggaggcccgcacggtcgtcctcggtcacatccagcgcggtggcaccccgaccgcg
ttcgaccgggtgctctccacccgcttcggcctgcaggcgatcgacgcggtcaacgatggc
gacttcggcaagatggtggcgctgcgcggcaccgacatcgtccggatcccgctcatcgag
ggcaccggcgagctgaagaccgttccgctggagcggtacgaagaggctgaggtcttcttc
ggtaactga

DBGET integrated database retrieval system