KEGG   Actinoplanes missouriensis: AMIS_15190Help
Entry
AMIS_15190        CDS       T01795                                 

Definition
putative UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ams  Actinoplanes missouriensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AMIS_15190
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMIS_15190
Enzymes [BR:ams01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     AMIS_15190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634000..1635484
Genome map
AA seq 494 aa AA seqDB search
MNVAPYPLRQLAELLSTEPAGADIDVTGVTHSSGAVRPGDLYAALPGANRHGAEFIPAAV
QAGAVAVLTNPAGRQAAADAGLPVLVVDDPRAVLGAVAAAIYGEPSRRLTMIGITGTAGK
TSTSYLVEAGLRAAGLVTGLVGTVETRIGDLVVKSVRTTPEATDLQAILAAGVERGVSAV
VMEVSSHALVMGRADGIRFAAAGYTNFGQDHLDFHPTSEEYFEAKARLFDGRSAVEVLNH
DDDAVMRLNRDESVTYSASGDQRATWWASGVRPSDYGQTFTAHGPDGITVETGVALPGLH
NVANALLALAVLVGAGIDATVAGRGIAACKGVPGRLEQVDAPGEILGVVDYAHKPNAIVA
ALAALRELATGRGGRLICVIGAGGDRDKGKRPLMGDAAAHGADLVIVTDDNPRTEDPAAI
RAAVRQGAEQAAAPAKVIEVDGRRAAIGEAVRLASAGDVIAVLGKGNEQGQEVNGEVLPF
DDRIELAAALGERS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgcgccgtacccgttgaggcagctcgctgagttgctgagcacggaaccggcg
ggcgctgacatcgatgtcactggggtcactcacagtagtggggcagtacgccccggcgac
ctgtacgcggctctgcccggtgcgaaccggcacggcgcggagttcatcccggcggcggtc
caggccggcgccgtggcggtgctcaccaacccggcgggacggcaggcggcggccgacgcc
gggctgccggtgctcgtcgtcgacgacccgcgggcggtgctcggcgcggtcgcggcagcg
atctacggcgagccgtcgcggcggctcaccatgatcggcataaccggcaccgcgggcaag
acctccacgtcgtacctggtggaggcgggactgcgggcggccgggctcgtcaccgggctg
gtcgggaccgtggagacgcggatcggcgacctcgtggtgaagagcgtccggaccaccccg
gaggccaccgacctgcaggccatcctcgccgcgggggtggagcgcggggtgtccgccgtc
gtgatggaggtgtccagccatgccctcgtgatggggcgggcggacgggatccggttcgcg
gcggccggttacacgaacttcgggcaggaccacctcgacttccacccgacgtccgaggag
tacttcgaggccaaggcccgccttttcgacggcaggtcagcggttgaggtgctgaatcac
gatgatgacgcggttatgcgcttaaatcgtgacgaatcggtcacgtactcggccagtggc
gaccagcgggcgacctggtgggcctccggcgtccggccgtccgactacgggcagaccttc
accgcccacgggccggacgggatcaccgtcgagaccggcgtggcgctccccggcctgcac
aacgtcgcgaacgcgctgctcgcgctcgccgtcctggtcggcgccggcatcgacgccacg
gtggccggccggggcatcgccgcgtgcaagggcgtgcccggccggctcgagcaggtggac
gcgcccggcgagatcctcggcgtggtcgattacgcgcacaagccgaacgcgatcgtcgcc
gcgctcgccgcgctccgtgagctcgccaccggccgtggcggccggctgatctgcgtgatc
ggcgccggcggcgaccgggacaagggcaagcggccgctgatgggcgacgccgcggcgcac
ggcgcggacctggtgatcgtcaccgacgacaacccgcgcaccgaggacccggccgcgatc
cgggccgcggtccgtcagggcgccgagcaggccgcggcgcctgccaaggtcatcgaggtg
gacggccggcgcgcggcgatcggcgaggcggtccggctggcctcggccggtgacgtgatc
gccgtcctgggcaagggcaacgagcagggccaggaggtgaacggcgaggtgctgccgttc
gacgaccgtatcgagttggccgccgcgttgggagaacgttcatga

DBGET integrated database retrieval system