KEGG   Actinoplanes missouriensis: AMIS_15410Help
Entry
AMIS_15410        CDS       T01795                                 

Definition
putative histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ams  Actinoplanes missouriensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_15410
  Amino acid metabolism
   00340 Histidine metabolism
    AMIS_15410
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AMIS_15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1659478..1660788
Genome map
AA seq 436 aa AA seqDB search
MLNRIDLRGSSRDPRGLLPRAQLDVSVAVERIRPVVEAVHEHGFSAIREATEKFDGVRLD
RLRVPAEAIAAAEETLDPDVRAALLEAIKRARKVHRDQRRTDTTTTVVPGGTVTERWVPV
RRVGLYVPGGLAVYPSTVVMNVVPAQEAGVEGLVVASPPQVANGGLPDARVLAACALLGV
TEVYAVGGAQAIAMLGYGADGADAADRCAPVDVITGPGNIWVTAAKRLLRGVVGIDAEAG
PTEIAILADETADPRHVAADLISQAEHDPLAASVLVTDSPALADAVEAELAVQVTKTKHD
ERVRTALTGEQSGVVLVDDLEQGLRVVDEYAAEHLEIQTRDAREWALRVRNAGAIFVGAW
SPVSLGDYAAGSNHVLPTGGCARHSSGLSVQSFLRGIHVVEYDEAALKDVAGHVVALSTA
EDLPAHGDAVKARFAQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaatcggatcgacctgcgcggctcctcccgtgacccgcgcggcctgctgccccgt
gcccagctcgacgtctcggttgccgtcgagcggatccgcccggttgtcgaggcggtccat
gagcatgggttcagcgcgatccgggaggcgacggagaaattcgacggcgtacggctggat
cgcctgcgcgttccggccgaggcgatcgccgccgccgaggagacgctcgaccccgacgtg
cgcgccgcgctgctcgaggcgatcaagcgggcccgcaaggtgcaccgtgaccagcgtcgc
accgacaccaccaccacggtggtgccgggcggcacggtcaccgagcgctgggtgccggtc
cgccgggtcggtctctacgtgccgggcggcctggccgtctacccgtccaccgtggtcatg
aacgtggtgcccgcccaggaggccggcgtcgagggcctggtggtcgcctcgccgccgcag
gtcgccaacggcggcctgccggacgcccgggtgctggccgcctgcgcgctgctcggcgtg
accgaggtctacgcggtcggcggcgcccaggcgatcgccatgctcggttacggcgccgac
ggcgccgacgcggccgacaggtgcgcgccggtcgacgtgatcaccggtcccggcaacatc
tgggtcaccgccgcgaagcgcctgctccgcggcgtggtcgggatcgacgccgaggcgggc
cccaccgagatcgcgatcctcgccgacgagaccgccgacccgcggcacgtcgcggccgac
ctgatcagccaggccgagcacgacccgctcgccgcgagcgtgctggtcaccgactcgccg
gccctggccgacgcggtcgaggcggagctcgccgtgcaggtgacgaagaccaagcacgac
gagagggtccgcacggcgctgaccggcgagcagtccggtgtggtgctggtcgacgacctg
gagcagggtctgcgggtcgtggacgagtacgcggcggagcacctggagatccagacgcgg
gacgcccgggagtgggccctgcgggtccgcaacgccggtgcgatcttcgtgggcgcctgg
tcgccggtctcgctcggtgactacgcggccggctcgaaccacgtgctgcccaccggcggc
tgcgcgcggcactcgtccggcctgtcggtgcagtcgttcctgcgcggcatccacgtcgtg
gagtacgacgaggcggccctcaaggacgtcgccgggcacgtggtggccctgtccaccgcc
gaggacctccccgcgcacggggacgctgtgaaggccaggttcgctcagtga

DBGET integrated database retrieval system