KEGG   Actinoplanes missouriensis: AMIS_15650Help
Entry
AMIS_15650        CDS       T01795                                 

Definition
putative indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ams  Actinoplanes missouriensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_15650
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_15650
Enzymes [BR:ams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AMIS_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683034..1683894
Genome map
AA seq 286 aa AA seqDB search
MTSDQAEAGSGGPAKAPQNVLEEILAGVREDVAARQERTPLEKVRELAAAAPPAIDAYAA
LRKPGVAVIAEVKRSSPSKGTLADIPDPAELAGEYAAGGARCISVLTEGRWFGGSLDDLV
AVRKSVKIPVLRKDFVVSSYQVHEARAHGADLVLLIVAALEQNVLVGLLERIESLGMTAL
VEVHNEEEADRALEANAKVIGVNARDLRTLEVDRSVFERIAPGLPNNVVKIAESGVRGPH
DLIRYASAGADAVLVGEGLVTQKSPRDAVAELVNAGNHPATPRPVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgacatccgatcaggcggaagcgggcagtggcggccccgcgaaagctccgcagaacgtt
ctcgaggaaatcctcgccggtgtgcgtgaggatgtagcggcgcgccaggagcgcacgccg
ctggagaaggtgcgtgagctcgcggcggcggctccgcccgcgatcgacgcgtacgccgcg
ttgcgcaagcccggcgtggcggtgatcgccgaggtgaagcgctcgtcgccgtccaagggc
acgctcgccgacatcccggacccggccgagctggccggggagtacgcggccggcggcgcg
cgctgcatcagcgtgctcaccgagggccgctggttcggcggctcgctggacgacctcgtc
gccgtgcgcaagtcggtcaagatcccggtcctgcgcaaggacttcgtggtctccagctat
caggtgcacgaggcgcgggcacacggcgccgacctggtgctgctgatcgtcgcggccctc
gagcagaacgttctggtcggcctcctggagcgcatcgagtcgctgggcatgaccgccctc
gtcgaggtgcacaacgaggaggaggcggaccgggcgctggaggcgaacgcgaaggtcatc
ggggtcaacgcccgcgacctgcgcaccctcgaggtggaccggtcggtcttcgagcgcatc
gcgccgggcctgccgaacaacgtggtcaagatcgccgagtccggcgtgcgcgggccgcac
gacctgatccggtacgcgtccgccggcgccgacgcggtgctggtcggcgagggcctggtc
acccagaagtcgccgcgggacgcggtggccgaactggtgaacgcgggcaaccacccggcg
acgccccggccggtccgatga

DBGET integrated database retrieval system