KEGG   Actinoplanes missouriensis: AMIS_15650Help
Entry
AMIS_15650        CDS       T01795                                 

Definition
(GenBank) putative indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01130  Biosynthesis of antibiotics
ams01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_15650
Enzymes [BR:ams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AMIS_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth B12-binding QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAL86785
UniProt: I0H198
Position
1683034..1683894
Genome map
AA seq 286 aa AA seqDB search
MTSDQAEAGSGGPAKAPQNVLEEILAGVREDVAARQERTPLEKVRELAAAAPPAIDAYAA
LRKPGVAVIAEVKRSSPSKGTLADIPDPAELAGEYAAGGARCISVLTEGRWFGGSLDDLV
AVRKSVKIPVLRKDFVVSSYQVHEARAHGADLVLLIVAALEQNVLVGLLERIESLGMTAL
VEVHNEEEADRALEANAKVIGVNARDLRTLEVDRSVFERIAPGLPNNVVKIAESGVRGPH
DLIRYASAGADAVLVGEGLVTQKSPRDAVAELVNAGNHPATPRPVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgacatccgatcaggcggaagcgggcagtggcggccccgcgaaagctccgcagaacgtt
ctcgaggaaatcctcgccggtgtgcgtgaggatgtagcggcgcgccaggagcgcacgccg
ctggagaaggtgcgtgagctcgcggcggcggctccgcccgcgatcgacgcgtacgccgcg
ttgcgcaagcccggcgtggcggtgatcgccgaggtgaagcgctcgtcgccgtccaagggc
acgctcgccgacatcccggacccggccgagctggccggggagtacgcggccggcggcgcg
cgctgcatcagcgtgctcaccgagggccgctggttcggcggctcgctggacgacctcgtc
gccgtgcgcaagtcggtcaagatcccggtcctgcgcaaggacttcgtggtctccagctat
caggtgcacgaggcgcgggcacacggcgccgacctggtgctgctgatcgtcgcggccctc
gagcagaacgttctggtcggcctcctggagcgcatcgagtcgctgggcatgaccgccctc
gtcgaggtgcacaacgaggaggaggcggaccgggcgctggaggcgaacgcgaaggtcatc
ggggtcaacgcccgcgacctgcgcaccctcgaggtggaccggtcggtcttcgagcgcatc
gcgccgggcctgccgaacaacgtggtcaagatcgccgagtccggcgtgcgcgggccgcac
gacctgatccggtacgcgtccgccggcgccgacgcggtgctggtcggcgagggcctggtc
acccagaagtcgccgcgggacgcggtggccgaactggtgaacgcgggcaaccacccggcg
acgccccggccggtccgatga

DBGET integrated database retrieval system