KEGG   Actinoplanes missouriensis: AMIS_15660Help
Entry
AMIS_15660        CDS       T01795                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00260  Glycine, serine and threonine metabolism
ams00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01130  Biosynthesis of antibiotics
ams01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_15660
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_15660
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMIS_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAL86786
UniProt: I0H199
Position
1683891..1685132
Genome map
AA seq 413 aa AA seqDB search
MTAPSLPDLAGHFGRYGGRFVPEALIKALDELDAAYRSAKADPEFQARFQDLLLNYAGVP
SLLYRATRLSEALGAEILLKREDLNHTGAHKVRNVLGQALLAKRMGKPRVIAETGAGQHG
VASATAAALLDLECVVYMGEMDTERQALNVARMRMLGATVVPVTNGSRTLKDALNEALRD
WVTTVDTTHYLLGTAAGPHPFPELVRDFVGGIGVEARAQCLELTGRLPDAVAACVGGGSN
AIGIFHAFVPDSSVRLYGFEAGGDGVETGRHAASITGGSVGVLHGNRTYLLQDDDGQTIE
SHSISAGLDYPGVGPEHAWLHDTGRASYEPVTDAEAMAAFQLLCRTEGIIPAIESSHALA
GAAKIAPRLREELGRTPTIVINLSGRGDKDVHTAGAYFGILDPVETVVPGENT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccctcgcttcccgacctggccggtcacttcgggcggtacggcggccggttc
gtgccggaagcgctgatcaaggcgctggacgagctggacgcggcgtaccgctcggcgaag
gcggacccggagttccaggcccggttccaggacctgctgctcaactacgccggcgtgccg
tccctgctgtaccgggcgacccggctctccgaggcgctcggcgcggagatcctgctgaag
cgggaggacctgaaccacaccggcgcccacaaggtgcgcaacgtgctgggtcaggcgctg
ctcgccaagcggatgggcaagccccgggtgatcgccgagaccggcgccggccagcacggt
gtcgcgagcgccacggcggccgcgctgctcgacctcgagtgcgtggtctacatgggcgag
atggacaccgagcggcaggcgctcaacgtggcccggatgcggatgctcggcgccaccgtg
gtcccggtgacgaacggctcgcgcaccctgaaggacgcgctcaacgaggcgctccgcgac
tgggtgacgaccgtcgacaccacccactacctgctcggcaccgcggccgggccgcacccg
ttcccggagctggtccgcgacttcgtcggcggcatcggcgtcgaggcgcgggcgcagtgc
ctggagctgaccggcaggctgccggacgccgtggcggcctgtgtcggcggcggctccaac
gccatcggcatcttccacgcgttcgtgcccgattcctcggttcgcctctacggcttcgag
gccggcggcgacggcgtggagaccggccggcacgcggcgtcgatcaccggtggctcggtg
ggcgtgctgcacggcaaccggacgtacctgctgcaggacgacgacgggcagaccatcgag
tcgcactcgatctcggcgggcctggactacccgggcgtcggcccggagcatgcctggctg
cacgacaccgggcgggcgtcctacgagccggtcaccgatgccgaggcgatggcggcgttc
cagctgctctgccgcaccgaggggatcatcccggcgatcgagagctcacacgccctggcc
ggggccgcgaagatcgcgccgcggctgcgcgaggagctgggccggaccccgaccatcgtg
atcaacctgtccgggcgcggcgacaaggacgtgcacacggccggcgcctacttcggcatc
ctcgacccggtcgagacggtcgtccccggggagaacacgtga

DBGET integrated database retrieval system