KEGG   Actinoplanes missouriensis: AMIS_15660Help
Entry
AMIS_15660        CDS       T01795                                 

Definition
putative tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ams01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ams00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ams00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683891..1685132
Genome map
AA seq 413 aa AA seqDB search
MTAPSLPDLAGHFGRYGGRFVPEALIKALDELDAAYRSAKADPEFQARFQDLLLNYAGVP
SLLYRATRLSEALGAEILLKREDLNHTGAHKVRNVLGQALLAKRMGKPRVIAETGAGQHG
VASATAAALLDLECVVYMGEMDTERQALNVARMRMLGATVVPVTNGSRTLKDALNEALRD
WVTTVDTTHYLLGTAAGPHPFPELVRDFVGGIGVEARAQCLELTGRLPDAVAACVGGGSN
AIGIFHAFVPDSSVRLYGFEAGGDGVETGRHAASITGGSVGVLHGNRTYLLQDDDGQTIE
SHSISAGLDYPGVGPEHAWLHDTGRASYEPVTDAEAMAAFQLLCRTEGIIPAIESSHALA
GAAKIAPRLREELGRTPTIVINLSGRGDKDVHTAGAYFGILDPVETVVPGENT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccctcgcttcccgacctggccggtcacttcgggcggtacggcggccggttc
gtgccggaagcgctgatcaaggcgctggacgagctggacgcggcgtaccgctcggcgaag
gcggacccggagttccaggcccggttccaggacctgctgctcaactacgccggcgtgccg
tccctgctgtaccgggcgacccggctctccgaggcgctcggcgcggagatcctgctgaag
cgggaggacctgaaccacaccggcgcccacaaggtgcgcaacgtgctgggtcaggcgctg
ctcgccaagcggatgggcaagccccgggtgatcgccgagaccggcgccggccagcacggt
gtcgcgagcgccacggcggccgcgctgctcgacctcgagtgcgtggtctacatgggcgag
atggacaccgagcggcaggcgctcaacgtggcccggatgcggatgctcggcgccaccgtg
gtcccggtgacgaacggctcgcgcaccctgaaggacgcgctcaacgaggcgctccgcgac
tgggtgacgaccgtcgacaccacccactacctgctcggcaccgcggccgggccgcacccg
ttcccggagctggtccgcgacttcgtcggcggcatcggcgtcgaggcgcgggcgcagtgc
ctggagctgaccggcaggctgccggacgccgtggcggcctgtgtcggcggcggctccaac
gccatcggcatcttccacgcgttcgtgcccgattcctcggttcgcctctacggcttcgag
gccggcggcgacggcgtggagaccggccggcacgcggcgtcgatcaccggtggctcggtg
ggcgtgctgcacggcaaccggacgtacctgctgcaggacgacgacgggcagaccatcgag
tcgcactcgatctcggcgggcctggactacccgggcgtcggcccggagcatgcctggctg
cacgacaccgggcgggcgtcctacgagccggtcaccgatgccgaggcgatggcggcgttc
cagctgctctgccgcaccgaggggatcatcccggcgatcgagagctcacacgccctggcc
ggggccgcgaagatcgcgccgcggctgcgcgaggagctgggccggaccccgaccatcgtg
atcaacctgtccgggcgcggcgacaaggacgtgcacacggccggcgcctacttcggcatc
ctcgacccggtcgagacggtcgtccccggggagaacacgtga

DBGET integrated database retrieval system