KEGG   Actinoplanes missouriensis: AMIS_15670Help
Entry
AMIS_15670        CDS       T01795                                 

Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_15670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_15670
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_15670
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMIS_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1685129..1685968
Genome map
AA seq 279 aa AA seqDB search
MSSSANPAAENRMQNRIGATFEKAKSENRAVLVGCMPAGFPTVDDSIEQMIEMHRAGCDV
IEVEMPYSDPVMDGPVIQKASDIALANGVRTRDTLKIIDAVSSAGATVVLMTYWNPIEKY
GVDAFARDLAAAGATGLITPDLIPDEAGEWIDASDQHHIDRTFLVAPSSTDERIAMTLAN
CRGFVYATALMGVTGARTSVSSQAPELVARIRATDPSMPIGVGLGVGNGAQAAEVAAFAD
GVIVGSALIRCVLEAPDRKTGLERLRALSAELAEGVRTR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagctctgctaaccccgcggcggaaaaccgaatgcaaaaccgtattggggcgacc
ttcgagaaggcgaagtccgagaaccgcgcggtgctggtcggctgcatgccggccggcttc
ccgacggtcgacgacagcatcgagcagatgatcgagatgcaccgtgcggggtgcgacgtc
atcgaggtcgagatgccgtactcggacccggtcatggacggcccggtgatccagaaagcg
agcgacatcgcgctcgccaacggtgtccgcaccagggacaccctgaagatcatcgacgcg
gtctcgtcggccggcgccaccgtggtgctgatgacctactggaacccgatcgagaagtac
ggtgtcgacgcgttcgcccgtgacctcgcggcggccggggccaccgggctgatcacgccc
gacctgatcccggacgaggcgggcgagtggatcgacgcttcagatcaacaccacatcgac
cgtacgttcctggtcgcgccgagctcgaccgacgagcgcatcgcgatgaccctcgcgaac
tgccgcggtttcgtctacgccaccgcgctgatgggcgtgaccggcgcccgtacctcggtc
tcctcccaggctccggagctggtggcccggatccgggcgaccgatccctcgatgccgatc
ggggtgggtctcggtgtcggcaacggcgcacaggccgccgaggtggcggcgttcgccgac
ggggtgatcgtcggcagcgcgctgatccgctgcgtgctcgaggcaccggaccgcaagacc
gggctggagcggcttcgcgccctgagcgctgaactggccgaaggcgtacgcacccgctga

DBGET integrated database retrieval system