KEGG   Actinoplanes missouriensis: AMIS_15670Help
Entry
AMIS_15670        CDS       T01795                                 

Definition
putative tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_15670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_15670
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_15670
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMIS_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685129..1685968
Genome map
AA seq 279 aa AA seqDB search
MSSSANPAAENRMQNRIGATFEKAKSENRAVLVGCMPAGFPTVDDSIEQMIEMHRAGCDV
IEVEMPYSDPVMDGPVIQKASDIALANGVRTRDTLKIIDAVSSAGATVVLMTYWNPIEKY
GVDAFARDLAAAGATGLITPDLIPDEAGEWIDASDQHHIDRTFLVAPSSTDERIAMTLAN
CRGFVYATALMGVTGARTSVSSQAPELVARIRATDPSMPIGVGLGVGNGAQAAEVAAFAD
GVIVGSALIRCVLEAPDRKTGLERLRALSAELAEGVRTR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagctctgctaaccccgcggcggaaaaccgaatgcaaaaccgtattggggcgacc
ttcgagaaggcgaagtccgagaaccgcgcggtgctggtcggctgcatgccggccggcttc
ccgacggtcgacgacagcatcgagcagatgatcgagatgcaccgtgcggggtgcgacgtc
atcgaggtcgagatgccgtactcggacccggtcatggacggcccggtgatccagaaagcg
agcgacatcgcgctcgccaacggtgtccgcaccagggacaccctgaagatcatcgacgcg
gtctcgtcggccggcgccaccgtggtgctgatgacctactggaacccgatcgagaagtac
ggtgtcgacgcgttcgcccgtgacctcgcggcggccggggccaccgggctgatcacgccc
gacctgatcccggacgaggcgggcgagtggatcgacgcttcagatcaacaccacatcgac
cgtacgttcctggtcgcgccgagctcgaccgacgagcgcatcgcgatgaccctcgcgaac
tgccgcggtttcgtctacgccaccgcgctgatgggcgtgaccggcgcccgtacctcggtc
tcctcccaggctccggagctggtggcccggatccgggcgaccgatccctcgatgccgatc
ggggtgggtctcggtgtcggcaacggcgcacaggccgccgaggtggcggcgttcgccgac
ggggtgatcgtcggcagcgcgctgatccgctgcgtgctcgaggcaccggaccgcaagacc
gggctggagcggcttcgcgccctgagcgctgaactggccgaaggcgtacgcacccgctga

DBGET integrated database retrieval system