KEGG   Actinoplanes missouriensis: AMIS_16120Help
Entry
AMIS_16120        CDS       T01795                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00051  Fructose and mannose metabolism
ams00562  Inositol phosphate metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
ams01230  Biosynthesis of amino acids
Module
ams_M00002  Glycolysis, core module involving three-carbon compounds
ams_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_16120
   00051 Fructose and mannose metabolism
    AMIS_16120
   00562 Inositol phosphate metabolism
    AMIS_16120
Enzymes [BR:ams01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMIS_16120
Exosome [BR:ams04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMIS_16120
  Exosomal proteins of bladder cancer cells
   AMIS_16120
  Exosomal proteins of melanoma cells
   AMIS_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MlaE
Motif
Other DBs
NCBI-ProteinID: BAL86832
UniProt: I0H1E5
Position
1741624..1742412
Genome map
AA seq 262 aa AA seqDB search
MMTTRKPIIAGNWKMNLNHFEAILLVRKLAEHLNAAQLDAVETVVLPPFTDLRSVQAAVE
DDKLNIKFGAQDVSQHVSGAYTGEISGGMLAKLGCSYVVIGHSERREYHNETDELINAKI
KAAFAAGLTPIFCVGEGLSVREESAHVGHCTAQVDAGLDGLKEDQIKQIVIAYEPVWAIG
TGKTATPDDAQEVCGAIRARLAEKFGADVADAVRIQYGGSVKAGNIASIMAQPDVDGALV
GGAALDAEGFASIVRFPEHVAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacgacccgtaagccgatcattgccggcaactggaagatgaacctcaaccacttc
gaggccatcctcctggtccgcaagctggccgagcacctgaacgccgcgcagctcgacgcc
gtcgagaccgtggtgctgccgcccttcaccgacctgcgcagcgtgcaggccgcggtcgag
gacgacaagctgaacatcaagttcggcgctcaggacgtctcgcagcacgtgtccggcgcg
tacaccggggagatctccggcggcatgctggcgaagctgggctgctcctacgtggtgatc
gggcactccgagcgccgcgagtaccacaacgagaccgacgagctgatcaacgcgaagatc
aaggcggccttcgcggccggcctcaccccgatcttctgcgtcggcgagggtctttcggta
cgcgaggagtccgcgcacgtgggccactgcacggcgcaggtcgacgcgggcctggacggg
ctcaaggaagaccagatcaagcagatcgtcatcgcgtacgagccggtctgggcgatcggc
accggcaagaccgcgacgccggacgacgctcaggaggtctgcggcgcgatccgtgcgcgg
ctcgccgagaagttcggcgccgacgtggccgacgcggtccgcatccagtacggcggctcg
gtcaaagcaggcaacatcgcctcgatcatggcgcagccggacgtggacggcgctctggtc
ggcggcgcggccctggacgccgagggcttcgcctcgatcgtgcgcttcccggagcacgtg
gcacgctga

DBGET integrated database retrieval system