KEGG   Actinoplanes missouriensis: AMIS_18940Help
Entry
AMIS_18940        CDS       T01795                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ams  Actinoplanes missouriensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMIS_18940
   00500 Starch and sucrose metabolism
    AMIS_18940
Enzymes [BR:ams01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AMIS_18940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2077922..2078938
Genome map
AA seq 338 aa AA seqDB search
MRRRMFLAIPAAAAIPAPRRLRLTVAADGTGDHTSVQAAIDAVPAGEPAIIGVRPGTYLG
QVIIPAGKPMIELRGLGRSPADVVIADDRANGTPKPDGGTWGTSGSASVTVDGAGLRVTR
LTFANLFDEAAHPEITNRQAVAVLTRADRLVFDRVRFLGNQDTLYVNSSAAGVIARAYFR
DCYVEGDVDFIFGRATAVFDRCHIHSLNRASTPAGYVTAPSTDRTNPYGLLFHRSRFTSD
APPGSVFLGRPWHPSQDPEAIGQTIIRESWIGAHIPAAPWTDFGTWPWEEARFAEYRNTG
PGATVTPDRPQLTREEAAAYTVDAALRGADGWNPCGRG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacggatgttcctggcgattcccgccgccgcggcgattccggctccccggcgg
ctgcggctgaccgtggcggcggacggcaccggcgaccacaccagcgtgcaggccgcgatc
gacgcggtcccggccggcgagcccgcgatcatcggggtacgccccggaacgtacctcggt
caggtgatcatcccggccggcaagccgatgatcgaactgcgcgggctcgggcgctcaccc
gccgacgtggtgatcgccgacgaccgggccaacggcaccccgaaaccggacggcggcacc
tggggaacctcgggcagcgcctcggtcaccgtggacggcgccggcctgcgggtcacgcgc
ctgaccttcgcgaacctcttcgacgaggccgcccacccggagatcaccaaccggcaggcg
gtcgcggtgctgacccgcgccgaccggctggtcttcgaccgggtccggttcctcggcaac
caggacaccctctatgtgaacagctcggcggccggggtgatcgcgcgggcgtacttccgg
gactgctacgtcgagggcgacgtcgacttcatcttcggccgggccaccgccgtcttcgac
cgctgccacatccactcgctgaaccgggcgagcacgcccgccggttacgtgaccgcgccc
agcaccgaccgcaccaacccgtacggcctgctcttccaccgttcccgcttcacctcggac
gccccgcccggatccgtcttcctgggccgtccgtggcaccccagccaggaccccgaggcg
atcgggcagacgatcatccgggagtcctggatcggcgcgcacatcccggccgcgccgtgg
accgacttcggcacgtggccgtgggaggaggcccgcttcgccgagtaccgcaacaccggg
ccgggcgcgacggtcacccccgaccggccgcagctgacccgggaggaggcggccgcgtac
acggtggacgccgccctgcgcggcgccgacggctggaacccgtgcggccgcggctga

DBGET integrated database retrieval system