KEGG   Actinoplanes missouriensis: AMIS_19110Help
Entry
AMIS_19110        CDS       T01795                                 

Definition
putative acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ams  Actinoplanes missouriensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AMIS_19110
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_19110
   00650 Butanoate metabolism
    AMIS_19110
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AMIS_19110
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMIS_19110
   00622 Xylene degradation
    AMIS_19110
   00621 Dioxin degradation
    AMIS_19110
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AMIS_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092187..2093050)
Genome map
AA seq 287 aa AA seqDB search
MLTAAIVGSGNIGTDLMYKLLRSPVVSPQWMAGIDPSSPGLKRAAGNGLETGIGGAEWLL
TRDPLPDVVFEATSASVHRAHAPLYAAAGIRAIDLTPAAVGPAVVPSVNLGGHRDAANLN
LTTCGGQATIPMVAAVSRVTPVSYAEIVASVASRSAGPGTRANIDEFTRTTGRGLETIGG
AAKGKAIIVLNPAEPPLMMRDTVFCAVTPDADRDAVITSVTDMAADVARSVPGYRLLDEP
QFDLVGDVLRVGVFLEIEGSGDYLPPYAGNLDIMTAAATRVAEELVR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgccgcgatagtcggctccgggaacatcggcaccgacctgatgtacaaactg
ctgcgatcccccgtcgtctcgccacagtggatggccgggatcgatccgtcgagccccggt
ctgaaacgggccgccggcaacggattggagaccggaatcggtggcgcggaatggctgctc
acccgcgatccgctgcccgacgtggtgttcgaggcgacgtcggcgtccgtgcaccgggcc
catgccccgctctatgccgcggccggaatccgggcgatcgatctgacgccggccgctgtc
ggaccggccgtcgtcccgtcggtgaatctcggcgggcaccgcgacgccgccaatctgaat
ctgaccacctgcggcgggcaggcgaccattccgatggtcgccgcggtgtcccgggtgaca
cctgtctcctacgccgagatcgtcgcctcggtggcgtcgcgatcggccggtcccggcaca
cgggcgaacatcgacgaattcacccggaccaccggtcgcggactcgagacgatcggcggc
gcggccaaaggaaaggccatcatcgtgctgaatccggccgagccgccactgatgatgcgg
gacaccgtgttctgtgccgtcacgccggacgcggaccgggacgccgtcatcacctcggtc
accgacatggccgccgacgtggcccgatccgtgccgggatatcggctgctggacgagccg
cagttcgacctggtcggcgacgtcctgcgggtcggcgtgttcctcgagatcgagggcagc
ggggactatctgccgccgtatgccgggaacctggacatcatgaccgccgccgccacgcgg
gtcgccgaggagctggtgagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system