KEGG   Actinoplanes missouriensis: AMIS_19130Help
Entry
AMIS_19130        CDS       T01795                                 

Definition
putative FAD-dependent oxidoreductase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
ams  Actinoplanes missouriensis
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AMIS_19130
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     AMIS_19130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2093819..2095363)
Genome map
AA seq 514 aa AA seqDB search
MWDVVVVGFGAAGACAAIEAAEAGARVLVIDRFGGGGATAISGGVIYAGGGTRFQHQAKI
KDNPRLMYEYLRTETRDAVSPVTLRRFCEQSAEMLDWLTRHGVPFGSSVCPVKTSYPTNR
HYLYVSGSEDPPVPRGHRTRARGTSGHALHRALAEAVRAAGAEVHTQTRAIRLTGGGVEC
RTLTGWPRLAHRVLHRLSVKPGLYLPGLGRVLHRQVIRIEDRHSASRTIPARAVVLAAGG
FVFNREMMREHAPAYRRGLRLGTPGDDGSGIRLGVQAGGVTAHLDRVTLWRFLTPPSALA
GGLLVDRDGRRICAEWRYGAAIGDAVLRRPGGRAWLLVDAQLLAAARRQVWRETLWFQRW
QAWWMLGPAGPRMGRVSASDVEGVARRAGVDPAGLAATVRDAGRGGRGPWSLIDVSIGAR
GLPAPMLTLGGLAVNEETGELAVSESAGEPAIGAAANAGNERKVAVYAAGRNAAGICSGA
YVSGLSLADCVFSGRRAGRHSAAFALGGADAQRR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggacgtcgtcgtggtgggcttcggcgcggccggggcgtgcgccgcgatcgaggcc
gccgaggccggtgcacgggtcctggtgatcgacaggttcggtggcggcggcgcgacggcg
atctccggcggggtgatctacgccggcggcgggacccgcttccagcaccaagccaagatc
aaggacaacccccgcctcatgtacgagtatctccgcaccgaaacccgcgacgccgtctcg
ccggtgaccctgcggcggttctgtgagcagagcgcggagatgctggactggctgacccgc
cacggcgtcccgttcggctcgtcggtctgcccggtcaagacgtcctatccgacgaaccgg
cattacctctacgtctccgggagcgaggatccgcccgtaccccgtggtcatcgcacacgc
gcgagaggcacctccgggcatgcgctgcaccgggccctggccgaggcggtccgcgcagcg
ggcgccgaggttcacacgcagacccgcgcgatccggctgaccggcggcggcgtcgagtgc
cgcacgctgaccggctggccgcggctggcacaccgggtgctgcaccgcttgtccgtgaaa
cccggcctctacctgcccggactcggccgcgtcctgcatcggcaggtcatccgcatcgag
gaccgccattccgcgtcccggacgattccggcccgtgcggtggtgctcgccgccggcggt
ttcgtcttcaaccgggagatgatgcgcgagcacgcgccggcctaccgtcgcgggctgcgg
ctcggcacgcccggcgacgacggttcggggatccggctcggcgtccaggcgggcggggtc
accgcgcatctggaccgggtcacgctgtggcggttcctcaccccgccctcggcgctggcc
ggtggcctgctggtggaccgcgacgggcggcggatctgtgccgagtggcggtacggcgcg
gccatcggggacgcggtgctgcgccgtcccggcgggcgggcgtggctgctggtggacgcg
cagctgctggccgcggcgcggcggcaggtgtggcgggagacgctgtggttccaacggtgg
caggcctggtggatgctggggccggccgggccgaggatgggccgggtgagcgcgtccgat
gtggagggcgtggcacgccgggccggcgtggatccggccgggctggcggcgaccgtgcgc
gacgccggccgtggcgggcggggaccctggtcactgatcgacgtctcgatcggggcgcgc
gggctgccggcgccgatgctgacgctgggtgggctggcggtgaacgaggagaccggcgag
ctggcggtgagcgagtcagcgggcgagcccgcgatcggcgcggcggcgaacgccgggaat
gagcggaaagtcgccgtctatgcggcggggcggaatgcggcgggcatctgctcgggcgcc
tatgtgagcgggctgtcgctcgccgactgtgtcttctcgggacggcgggccgggcgtcat
tcggccgctttcgcactcggaggtgccgatgctcagcgacgatga

DBGET integrated database retrieval system