KEGG   Actinoplanes missouriensis: AMIS_19390Help
Entry
AMIS_19390        CDS       T01795                                 

Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ams  Actinoplanes missouriensis
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:ams00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122566..2124164)
Genome map
AA seq 532 aa AA seqDB search
MNITHRSVTRRDVLRIGALAAAGTLPALPALQGRTALVIGSGFGGAVAAWRLAQAGMVVT
VLERGRRWTVDGSGTTFCTISNPDWRCAWFGDRPPLGLDTSKPIERRAGLIQKHVGDGIQ
VMCGAGVGGGSLVIGMFLPQPRRADWEKVYPAELPYSEFEQTYWPRARQSLGAAPIPSDI
QNHPQYVGARSWLQYLSEFGRAAVPVPFGVNWDVIRDELAGRVVKCHAIGEGPFGSNSGA
KNSVDHNYLKWAEATGRVSVLPLHEVTSLREVSGSDRIEATARQIDETGAVLATKTFAAD
YLFLAAGSLNTTSLLLGSRARGGLPRLTGTEVGKGWGNNGDFLVARLNLRKPVGSAQGGP
GNVKFYDDSNPYAPAAMAWESAPMPSWLPNTTAHLITSLVSERGEIRYDAATGGGKVYWP
YAEMETAADRAGRDLATRLWWATEGSRGSLLTGLPSYDRNTGMGLGSRNTYHPLGGLVMG
RATDFGGKVAGYENLYCVDGALLPGSAALANPALTITANAERCLDRFLAAHA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcacccatcgcagcgtgacccgccgtgacgtattgcggatcggcgccctcgcg
gcggccggcacgctgcccgccctcccggcgctgcagggaaggaccgcgctggtgatcggg
agtggtttcggtggggccgtcgcggcctggcggctcgctcaggcaggaatggtcgtgacc
gttcttgaacggggacgacggtggactgtggacggctccgggacgacgttctgcacgatc
agcaacccggactggcgatgtgcgtggttcggtgaccggccgccgctcggcctggacacc
agcaagcccatcgagcgccgggccggcctcatccagaaacacgtcggcgacggcatccag
gtgatgtgcggggccggtgtgggcggcggctccctggtgatcggcatgttcctgccccag
ccccgccgcgccgactgggagaaggtctaccccgccgagctgccgtactccgagttcgag
cagacctactggccccgagcccggcagagtctcggcgccgcgcccatcccttcggacatc
cagaaccatccgcagtacgtcggagcgaggagctggctgcaatacctgtcggagttcggc
cgcgccgccgtgccggtgcccttcggcgtgaactgggatgtgatccgcgacgagctggcc
ggtcgggtggtcaagtgccacgcgatcggcgagggcccgttcggcagcaactcgggcgcc
aagaacagcgtggaccacaactacctgaagtgggccgaggcgaccggcagggtctccgtg
ctgccgctgcacgaggtcacgtccctgcgcgaggtgtccggttctgatcgcatcgaggcg
accgcgcggcagatcgacgagaccggggcggtgctggccaccaagacgttcgccgccgac
tacctgttcctcgcggccggatcgctgaacacgacatcgctgctgctcggctcccgggcg
cgcggcgggctgccccggctcaccggcaccgaggtcggcaagggctggggcaacaacggc
gacttcctggtggcccggctcaacctgcgcaagccggtcggcagcgcgcagggcgggccg
gggaacgtcaagttctacgacgactcgaacccgtacgcgcccgcggcgatggcgtgggag
tcggcgccgatgccgtcctggctgccgaacaccacggcgcacctgatcaccagcctggtg
agtgagcgcggggagatccgctacgacgcggcgaccggcggcggcaaggtctactggccg
tacgcggagatggagacggcggcggaccgggccggccgggacctcgcgacccggctctgg
tgggccaccgagggcagccggggcagcctgctgaccgggctgccctcctacgaccgcaac
accgggatgggactgggctcgcggaacacctatcacccgctcggcggcctggtgatgggc
cgggccaccgacttcggcggcaaggtcgccgggtacgagaacctgtactgcgtggacggc
gctctgctgcccggctcggcggcgctcgcgaacccggcgctgaccatcacggcgaacgcg
gaacgctgcctcgaccggttcctggccgcccacgcctaa

DBGET integrated database retrieval system