KEGG   Actinoplanes missouriensis: AMIS_21700Help
Entry
AMIS_21700        CDS       T01795                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00071  Fatty acid degradation
ams00280  Valine, leucine and isoleucine degradation
ams00281  Geraniol degradation
ams00310  Lysine degradation
ams00360  Phenylalanine metabolism
ams00362  Benzoate degradation
ams00380  Tryptophan metabolism
ams00410  beta-Alanine metabolism
ams00627  Aminobenzoate degradation
ams00640  Propanoate metabolism
ams00650  Butanoate metabolism
ams00903  Limonene and pinene degradation
ams00930  Caprolactam degradation
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01212  Fatty acid metabolism
Module
ams_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMIS_21700
   00650 Butanoate metabolism
    AMIS_21700
  Lipid metabolism
   00071 Fatty acid degradation
    AMIS_21700
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMIS_21700
   00310 Lysine degradation
    AMIS_21700
   00360 Phenylalanine metabolism
    AMIS_21700
   00380 Tryptophan metabolism
    AMIS_21700
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMIS_21700
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMIS_21700
   00281 Geraniol degradation
    AMIS_21700
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMIS_21700
   00627 Aminobenzoate degradation
    AMIS_21700
   00930 Caprolactam degradation
    AMIS_21700
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMIS_21700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAL87390
UniProt: I0H303
Position
complement(2252233..2252970)
Genome map
AA seq 245 aa AA seqDB search
MGVRLHSGAVAEVIIEFPPVNALPAEGWHTLARALGTAAADPRTRAVVLAADGRGFCAGV
DIKEMQRTEGHEALLAANRGCAAAFAAVYECPVPVIAAVHGFCLGGGVGLAGNADLVIAS
DDAVFGLPEVDRGALGAATHLARLVPHQLMRTMVYTCRTVPARDLVRFGTVLEVVPDRGL
RAAARRVAAEIAAKDPVVIRAAKASLNGIDPMDVKRSYRFEQGFTFELNLNGAGDRARQR
FVEGR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgcggctgcacagcggcgctgtcgctgaggtgatcatcgagttcccaccggtc
aacgcgctgccggcggagggctggcacacgctcgcccgcgcgctcggcacggccgccgcc
gatccccggacccgggccgtggtgctcgcggccgacgggcgtggcttctgcgcgggcgtc
gacatcaaggagatgcagcgcaccgagggtcacgaggcgctgctcgcggcgaaccggggg
tgcgcggcagcgttcgccgccgtctacgagtgcccggttccggtcatcgcggcggtgcac
gggttctgcctcggcggcggggtgggcctggccggcaacgccgacctggtgatcgcctcc
gacgacgcggtgttcggcctgcccgaagtcgatcggggcgcgctcggcgcggccacccat
ctggcccggctcgtcccgcaccagctgatgcggaccatggtctacacgtgccggacggtg
ccggcgcgggacctggtgcggttcgggacggtgctggaggtggtgccggacagagggctg
cgcgcggcggcgcggcgggtggcggcggagatcgcggccaaggacccggtcgtgatcagg
gcggccaaggcgtcgctcaacgggatcgatccgatggacgtgaagcggtcctaccggttc
gagcagggcttcaccttcgagctgaatctgaacggcgccggcgaccgggcgcggcagcgg
ttcgtggagggcagatga

DBGET integrated database retrieval system