KEGG   Actinoplanes missouriensis: AMIS_23740Help
Entry
AMIS_23740        CDS       T01795                                 

Definition
putative 3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ams  Actinoplanes missouriensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AMIS_23740
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AMIS_23740
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AMIS_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469126..2469881
Genome map
AA seq 251 aa AA seqDB search
MVVNLDLDGRVALVTGAGSGIGRACAVRLAEAGATVLVADVDDVAATEVAAAVGGRPVVA
DLSRPDAADGVRGDVDVLVNNAGLQHVSALPDFPPEKFAYLQRVMVEAPFRLVRRVLPHM
YARHWGRIVNISSVHGLIASPFKAAYVTAKHGLEGLSKTTALEGAPHGVTSNCVEPAFVR
TPLVDKQIADQARMHGIPEDQVIEEIMLERAAIKRLIAPEEVAELVAYLCTPSADLITGA
SIPIDGGWTAH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcaacctcgatctcgacggccgggtcgccctggtcaccggagcgggcagcggc
atcgggcgggcctgcgcggtccggctggccgaggccggcgcgacagtgctggtggcggac
gtggacgacgtcgccgccacggaggtcgcggcggccgtcggcgggcgaccggtggtcgcg
gacctgtcccggccggacgccgccgacggcgtgcgcggcgacgtggacgtgctggtcaac
aacgcgggcctgcagcacgtgtcggcgctgccggacttcccgccggagaagttcgcctac
ctgcaacgggtcatggtggaggcgccgttccggctggtccgcagggtgctgccgcacatg
tacgcccgccactggggccgcatcgtcaacatctcctcggtgcacgggctgatcgcgtcg
ccgttcaaggccgcctacgtcaccgccaagcacggactggagggcctgtcgaagacgacc
gcgctggagggcgcgccgcacggcgtcacctcgaactgcgtggagcccgcgttcgtgcgc
acgccgctcgtcgacaagcagatcgccgaccaggcccggatgcacggcatcccggaggac
caggtgatcgaggagatcatgctggagcgggccgcgatcaagcgcctgatcgcgcccgag
gaggtggccgagctggtcgcctacctgtgtacgccgtccgccgacctgatcaccggcgcg
tcgatcccgatcgacggcggctggaccgcgcactga

DBGET integrated database retrieval system