KEGG   Actinoplanes missouriensis: AMIS_24360Help
Entry
AMIS_24360        CDS       T01795                                 

Definition
putative dTDP-6-deoxy-4-ketoglucose epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ams  Actinoplanes missouriensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ams00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ams00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2547648..2548265
Genome map
AA seq 205 aa AA seqDB search
MKISPLGIEGAFEITPVQHGDARGSFLEWYRFDHLAEAVGHPLDLAQGNLSVSARDVVRG
IHFADVPPGQAKYVTCVKGAVLDVIVDIRVGSPTFGRWESVRLDDEDRKAVYLGEGLGHG
FCALTEGATVAYLCSTEYRPGREHGIHPLDPTLGIAWPAETPLLSGKDAQAPSLEEARDK
GLLPRYEECQNYAESLRRNHYSRTS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcagtccactgggcatcgagggcgccttcgagatcacgccggtgcagcacggc
gacgcccggggctcgttcctcgagtggtaccgcttcgaccatctggccgaggccgtcggg
cacccgctcgatctcgctcagggcaacctctccgtctcggcgcgtgacgtcgtccgcggg
atccacttcgctgacgtgccgccgggtcaggcgaaatatgtgacgtgcgtcaagggtgcc
gtgctcgacgtcatcgttgacatccgggtcggctcgccgacgttcggcagatgggagtcg
gtgcgcctcgacgacgaggaccgcaaggcggtgtacctgggcgaggggctcggtcacggg
ttctgcgcgctgacggagggtgccacggtggcgtacctctgctcgaccgagtaccggccc
ggccgggagcacggcatccacccgctcgaccccacgctgggcatcgcctggcctgcggag
acgccgctcctctcgggcaaggacgcgcaggcgccgtcgctcgaggaggcgcgtgacaag
ggtctgctgcctcgctacgaggagtgccagaactacgcggagtcactgcgtcggaatcac
tacagccgtacgtcctaa

DBGET integrated database retrieval system