KEGG   Actinoplanes missouriensis: AMIS_24620Help
Entry
AMIS_24620        CDS       T01795                                 

Definition
putative sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_24620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_24620
   00052 Galactose metabolism
    AMIS_24620
   00500 Starch and sucrose metabolism
    AMIS_24620
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_24620
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMIS_24620
   00524 Butirosin and neomycin biosynthesis
    AMIS_24620
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMIS_24620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2579647..2580606
Genome map
AA seq 319 aa AA seqDB search
MSPAMTTPAGIAAVDIGGTKIAVALVDDAGVVHQRVDVATPPGGSAILCVVAELVAGVCS
RAAVRAVGVGAPGVIDPVTGAVRSATDILPGWVGTPVKERLAARLGLPVAVANDVRAAAL
GAAHSADVREHRDILHVSVGTGIGGALIRDRQMVTGPHAVTGEIAHLLVPATGAVACGCG
RFDHLEAVAAGPAIAAAIAASAGGPVLPLDRMAVLPEARPIIGAAASVLGRTLAGLVAAV
DVDAITLGGGVVHGIPEFAGVVREAFQAEALPPLRTVPVLVPAAGPDAPLLGAAHLARQI
LSRQILADPVLALRMGARA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccagctatgacgacaccggccgggatcgcggcggtcgacatcggcggcacgaag
atcgccgtggccctggtcgacgacgccggcgtggtgcaccagcgcgtcgacgtcgccacc
ccgcccggcggctcggcgatcctctgcgtcgtcgccgaactcgtcgccggcgtgtgctca
cgcgcggcggtgcgggccgtcggcgtcggcgcgcccggcgtgatcgacccggtgaccggc
gcggtccggtccgccaccgacatcctgccgggctgggtcggcaccccggtcaaggaacgg
ctcgccgcccggctcggcctgccggtcgcggtcgccaacgacgtgcgggccgccgcgctc
ggcgccgcgcacagcgctgacgtgcgggaacaccgggacatcctgcacgtctcggtgggt
acgggcatcggcggcgcgctgatccgcgaccggcagatggtcaccggtccgcatgcggtc
accggggagatcgcgcacctgctcgtcccggcgaccggggcggtcgcctgcggctgcggc
cggttcgatcacctggaagccgtcgccgcggggccggccatagccgccgcgatcgccgcg
tcggccggtggtccggtgctgccgctcgatcggatggccgtcctgccggaggcgcggccg
atcatcggggcggcggcgagtgtgctcggccgtaccctcgccgggcttgtcgcagccgtg
gacgtggacgcgatcaccctcggcggcggcgtcgtgcacggcatccccgagttcgccggc
gtggtccgggaggccttccaggcagaggcgcttcccccattgcgtacggtgccggtcctg
gtgcccgccgccggaccggatgccccgttgctcggcgccgcccacctcgcccgccagatc
ctttcccgccagatcctcgccgacccggtcctcgccctccggatgggagcccgcgcatga

DBGET integrated database retrieval system