KEGG   Actinoplanes missouriensis: AMIS_28310Help
Entry
AMIS_28310        CDS       T01795                                 

Definition
putative alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ams  Actinoplanes missouriensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMIS_28310
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMIS_28310
   00600 Sphingolipid metabolism
    AMIS_28310
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMIS_28310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2981559..2983172
Genome map
AA seq 537 aa AA seqDB search
MIRKLAMTLAAALLVLLPLPSGPAHALDNGVARTPPMGWNSWNTFGCNINEGLIRGMADA
MVSSGMRDLGYQYVVVDDCWFNPNRDSAGNLQGDPTRFPSGMKALGDYLHGKGLKFGIYQ
GPLDKTCAQYFNSYPGATGSLGHEAQDARQFAAWGVDYLKYDWCSPTGTINDQVATFAKM
RDALAATGRPIVYSINPNSIHAKTGPQRNWGDVANMWRTTEDISDAWDTGQTNGYPMGVK
NIVDVTVPLAGYARPGGFNDPDMMEVGRGGMTDTEQRSHFALWAMMASPLIAGNDLRSMS
TATQTILKNPRLIAINQDTLGLQANQISYDGTRRVLAKRLANGDVAVALFNQGSAATTVS
TTAAAIGRSGSAFTLQDAWTGGTTTTSGTISATVPGHGTVVYRVSGGTTSPSTTTTLVSA
SSGRCLDVPNGNAANGTQPVIWDCNGGANQRWTTSGASIQALGKCLDAPIGATAGAKVQL
WDCNGQSNQQWTIQSDGTVRGAASGLCLDVDHNLTANGTRVLLWTCGTAANQRWSRV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaaaactggcgatgacgctcgcagctgccctgctcgtgctgctgccgctgccc
tccggaccggcccacgcgctcgacaacggtgttgcccgtacccctccgatgggatggaac
agctggaacaccttcggctgcaacatcaacgagggactgatccgcggcatggccgacgcg
atggtcagcagcggcatgcgcgacctcggctaccagtacgtcgtcgtcgacgactgctgg
ttcaacccgaaccgggactccgccggcaacctgcagggcgacccgacccgtttccccagc
ggcatgaaggcgctcggcgactacctgcacggcaagggcctgaagttcggcatctaccag
gggccgctcgacaagacctgcgcgcagtacttcaacagctatcccggcgccaccggcagc
ctgggtcacgaggcgcaggacgcgcgccagttcgccgcgtggggcgtcgactacctcaag
tacgactggtgctcaccgaccgggacgatcaacgaccaggtcgccacgttcgccaagatg
cgtgacgcgctcgccgccaccggacggccgatcgtctacagcatcaacccgaacagcatc
cacgccaagaccgggccgcagcgcaactggggcgacgtcgcgaacatgtggcgcaccacc
gaggacatcagcgacgcctgggacaccgggcagaccaacggctacccgatgggtgtcaag
aacatcgtggacgtcaccgtgccgctcgccggttacgcccggcccggcggtttcaacgac
ccggacatgatggaggtcggccggggcgggatgaccgacaccgagcagcgcagccacttc
gcgctctgggcgatgatggcctcgccgctgatcgccggcaacgacctgcgctcgatgagc
acggccacccagaccatcctgaagaacccccggctcatcgccatcaaccaggacacgctc
ggcctccaggccaaccagatctcgtacgacgggacgcgtcgcgtgctggccaagcggctc
gccaacggcgacgtggcggtcgccctcttcaaccagggctccgcggcgaccaccgtctcg
accaccgctgccgcgatcggcaggagcggcagcgcgttcaccctccaggacgcctggacc
ggcggcacgacgaccacctccggcacgatcagcgccacggtccccggccacggcacggtc
gtctaccgggtcagcggcgggacgaccagcccctccaccacgaccacgctcgtcagtgcc
tcgtcgggacgctgtctcgacgtacccaacggaaatgccgccaacggcacgcagccggtc
atctgggactgcaacggcggcgccaaccagcgctggaccacctccggcgcgagcatccag
gccctcggcaagtgcctggacgcgccgatcggcgcgaccgccggcgccaaggtccagctc
tgggactgcaacgggcagtccaaccagcagtggacgatccagtccgacggcaccgtccgc
ggcgccgcctcgggtctctgcctggacgtcgaccacaacctgaccgccaacggcacacgc
gtcctgctctggacctgcgggacggccgccaaccagcgatggagccgggtctga

DBGET integrated database retrieval system