KEGG   Actinoplanes missouriensis: AMIS_29900Help
Entry
AMIS_29900        CDS       T01795                                 

Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00052  Galactose metabolism
ams00561  Glycerolipid metabolism
ams00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMIS_29900
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMIS_29900
   00600 Sphingolipid metabolism
    AMIS_29900
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMIS_29900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 GHL10
Motif
Other DBs
NCBI-ProteinID: BAL88210
UniProt: I0H5C3
Position
complement(3147483..3149564)
Genome map
AA seq 693 aa AA seqDB search
MPDLRYVPEQRLWLLHTPSTSYAVALDDDDNVRHLHWGARLTTPAIREPAAGSSFDTAGG
PRELDAEGGARFGPAGLQVRFADGSRGVEWRYAGHDIDAGHLRIHLDDRHHPLRVTLHYR
VYDDTDVIERWTTVTNSGEPITVQRCDSASWTLPQRPGYRMSHLVGGWNSEFRLRRTDVP
VAETVFTSRRGMTSHQANPWLALDDGATGEEHGEVWSTALAWSGSWRITLHRDPAGHVAW
TGGPGHEGLTWTLGTGETLETPVYAGLYTGGGFGAASRAWHAYTRRHVVPHPAEVRPVLY
NSWEATGFDVDEAGQTALAARAARLGVELFVVDDGWFGERVSDHAGLGDWTPNPDRFPQG
LRPLADEVHRLGMLFGLWVEPEMVNPDSDLYRAHPDWVLHTAHRGRTEMRNQLVLNLARP
DTAAWTHAWLDRLVTDNDIDFLKWDANRAFTEAGWPGHADPDRLWLDHTRAVYQIMDRLR
ADHPGLRIEACSGGGGRADLGILARTDQVWTSDNTDPVDRIGIQHGFSQLFPAQVMGAWV
TDSPNVATARRTPLRFRFHVAMAGALGIGGDLTTWSEDELKEAAELIEVYKRIRPAVQHG
AAHRLTGDGTLSAVGYAHEDQFVLLAWCPSRPFGHDPAPLRLTGIDPAAEYRDTDTGAVH
SGAVLRQSGLDLDFPQGDHASVLVHLVRVDRKG
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatctgcggtacgtgcccgagcagcgcctctggctgttgcacaccccgtcgacg
tcgtacgccgtcgcgctcgacgacgacgacaacgtgcggcacctgcactggggtgcgcga
ctgaccacgcccgcgatccgggaaccggccgcgggcagcagcttcgacaccgccggcggc
ccgcgggaactggacgccgagggtggcgcccggttcgggccggccggcctgcaggtgcgg
ttcgccgacggcagtcgtggcgtcgagtggcgctacgccgggcacgacatcgacgccggc
cacctgcgcatccacctggacgaccggcaccacccgctgcgcgtcaccctgcactaccgg
gtgtacgacgacaccgacgtgatagagcggtggaccaccgtcacgaactccggcgagccg
atcaccgtacagcggtgcgacagcgcctcctggacgctgccgcagcgccccggctaccgg
atgagtcacctggtcggcggctggaacagcgagttccggctgcgccgcaccgacgtgccg
gtcgccgagaccgtcttcaccagccggcgtggcatgaccagtcaccaggccaacccctgg
ctcgccctggacgacggcgccaccggcgaggagcacggcgaggtgtggagcaccgcgctg
gcctggagcggcagctggcggatcaccctgcaccgtgacccggccgggcacgtcgcctgg
accggcggccccggccacgagggcctgacctggaccctcggcacgggcgagaccctggag
acgccggtgtacgccgggctctacaccggcggcgggttcggcgcggccagccgggcgtgg
cacgcgtacacccgccggcacgtcgtcccgcatcccgcggaggtacgcccggtgctctac
aactcgtgggaggccaccgggttcgacgtggacgaggccggccagacggcgctcgccgcc
cgggccgcccggctcggcgtcgaactgttcgtggtcgacgacggctggttcggcgaacgg
gtcagcgaccacgccggcctcggtgactggacgcccaacccggaccgcttcccgcagggg
ctgcgaccgctcgccgacgaggtgcaccggctcggcatgctcttcgggctctgggtcgag
cccgagatggtcaacccggactccgacctctaccgggcgcacccggactgggtgctgcac
accgcacaccgcgggcgcaccgagatgcgcaaccagctcgtcctcaacctggcccggccg
gacaccgccgcctggacgcacgcctggctggaccggctggtgaccgataacgacatcgac
ttcctcaagtgggacgcgaaccgcgcgttcaccgaggccggctggccgggccacgccgac
ccggaccggctgtggctggaccacacccgcgcggtctaccagatcatggaccggctccgc
gccgaccacccgggcctgcgcatcgaggcatgctccggcggcggcggccgggccgacctc
ggcatcctcgcccgcaccgaccaggtgtggacgtcggacaacaccgacccggtcgaccgg
atcggcatccagcacgggttcagccagctcttccccgcgcaggtcatgggcgcgtgggtg
accgacagcccgaacgtggccaccgcccgccggacgccgctgcggttccgcttccacgtc
gccatggccggcgcgctgggcatcggcggtgacctgaccacgtggtcggaggacgagctg
aaggaggccgccgagctgatcgaggtctacaagcggatccggccggcggtccagcacggc
gccgcccaccggctgaccggtgacggcacgctcagcgcggtcgggtacgcccacgaagac
cagttcgtcctgctcgcctggtgcccgtcccggccgttcggccacgaccccgcgccgctg
cggctgaccggaatcgaccccgcagccgagtaccgggacaccgacacgggagcggtgcac
tcgggggccgtactccggcagtcgggtcttgatcttgattttccgcagggtgaccacgcc
agcgtcctggtgcacctcgtccgcgttgacaggaaaggctga

DBGET integrated database retrieval system