KEGG   Actinoplanes missouriensis: AMIS_3110Help
Entry
AMIS_3110         CDS       T01795                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00620  Pyruvate metabolism
ams00640  Propanoate metabolism
ams00680  Methane metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_3110
   00620 Pyruvate metabolism
    AMIS_3110
   00640 Propanoate metabolism
    AMIS_3110
  Energy metabolism
   00680 Methane metabolism
    AMIS_3110
Enzymes [BR:ams01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMIS_3110
Lipid biosynthesis proteins [BR:ams01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMIS_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C
Motif
Other DBs
NCBI-ProteinID: BAL85531
UniProt: I0GXP4
Position
complement(326107..328095)
Genome map
AA seq 662 aa AA seqDB search
MSETLENLSSETRKFPPPAELAANANVKADAYDEANADRLAYWERQAERLTWAKKWDQVL
DWSNPPFAKWFVGGELNIAYNCVDRHVEAGNGDKVAIHWEGEPGDTRTVTYAELLKLVSQ
AANTLTDLGVTAGDRVMIYLPMIPEAAVAMLACARIGATHSVVFGGFSVDALSTRIQDAA
AKVVITADGGYRRGKPSALKPTVDEAVSRTDSIEHVLVVRRTGQDVAWTDKDKWWHETVE
QAAGSHEAQPFDSEHPLFILYTSGTTGKPKGILHTTGGYLTQTSYTHHAVFDLKPETDVY
WCTADIGWVTGHSYIVYGPLSNGATQVMYEGTPDTPDRGRFWQIVDKYKVSILYTAPTLI
RTMMKWGDDIPAKYDLSSLRVLGSVGEPINPEAWMWYREHVGRERTPIVDTWWQTETGAI
MISPLPGVTEAKPGSAMTPLPGIGADVVDDQAQSVPNGGGGFLVLREPWPSMLRTIWGDD
QRFLDTYWSRFGAGADSSSQEWIYFAGDGAKKDDDGALWLLGRVDDVMLVSGHNISTTEV
ESALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSVETEGAAGEELIKELRNHVAKTLG
PIAKPRQIMLVAELPKTRSGKIMRRLLRDVAENRSLGDVTTLQDSTVMDLISSGMKTGKS
ED
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccctggagaacttgtcctcggagacgcggaagttcccgccgcccgccgaa
ctcgcggcgaacgcgaacgtgaaggccgacgcctacgacgaggcgaacgccgaccggctg
gcctactgggagcgccaggccgagcgtctcacctgggccaagaagtgggaccaggtgctg
gactggtccaacccgccgttcgccaagtggttcgtcggcggtgagctgaacatcgcgtac
aactgcgtggaccggcacgtcgaggccggcaacggcgacaaggtcgccatccattgggag
ggcgagcccggcgacacccggaccgtcacctacgccgagctgctgaaactggtctcccag
gcggcgaacacgctgaccgatctgggcgtcacggccggcgaccgggtcatgatctacctg
ccgatgatcccggaggccgcggtggcgatgctcgcctgcgcccggatcggcgcgacgcac
agcgtggtcttcggtggcttctcggtggacgccctctccacccggatccaggacgccgcc
gccaaggtcgtgatcaccgcggacggcggttaccggcggggcaagccgtcggcgctcaag
ccgaccgtggacgaggcggtgtcgcgtaccgacagcatcgagcacgtgctggtggtccgc
cgcaccggccaggacgtcgcctggaccgacaaggacaagtggtggcacgagacggtcgag
caggccgccggctcgcacgaggcgcagccgttcgactccgagcacccgctcttcatcctc
tacacgtccggcaccaccggtaagccgaagggcatcctgcacaccaccggcgggtacctg
acgcagacgtcgtacacccatcacgcggtcttcgacctgaagcccgagaccgacgtctac
tggtgcaccgccgacatcggctgggtcaccggccactcgtacatcgtgtacggtccgctc
tccaacggcgcgacccaggtcatgtacgagggcaccccggacaccccggaccgcggccgg
ttctggcagatcgtcgacaagtacaaggtgtcgatcctctacaccgctccgacgctgatc
cgcacgatgatgaagtggggcgacgacatccccgccaagtacgacctgtcgtcgctgcgg
gtcctcggcagcgtgggcgagccgatcaaccccgaggcctggatgtggtaccgggagcac
gtcggccgggagcgcaccccgatcgtcgacacctggtggcagaccgagaccggcgcgatc
atgatctcgccgctgcccggcgtgaccgaggcgaagccggggtccgcgatgacgccgctg
cccggcatcggcgccgacgtggtcgacgaccaggcgcagtcggtgccgaacggcggcggc
ggtttcctggtgctgcgcgagccgtggccgtcgatgctgcgcaccatctggggcgacgac
cagcggttcctggacacgtactggtcccggttcggcgcaggcgccgactcctcttcccaa
gagtggatctacttcgccggcgacggcgccaagaaggacgacgacggcgccctctggctg
ctcggccgggtggacgacgtcatgctggtctccggccacaacatctccaccaccgaggtg
gagtcggcgctcgtctcgcacccgtcggtggccgaggcggccgtggtcggcgcgaccgac
ccgaccaccggccaggcgatcgtcgcgttcgccatcccgcgcggcagcgtggagaccgag
ggcgcggccggcgaggaactgatcaaggagctgcgcaaccacgtggcgaagacgctcggc
ccgatcgccaagccgcgtcagatcatgctcgtcgccgagctgccgaagacgcggtccggc
aagatcatgcggcgtttgctgcgcgatgtcgcggagaaccggtcgctcggtgacgtgacg
acgctccaggactcgacggtgatggatctgatctcgtccgggatgaagaccggcaagtcc
gaagactga

DBGET integrated database retrieval system