KEGG   Actinoplanes missouriensis: AMIS_33290Help
Entry
AMIS_33290        CDS       T01795                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ams  Actinoplanes missouriensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AMIS_33290
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AMIS_33290
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AMIS_33290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3502424..3502918)
Genome map
AA seq 164 aa AA seqDB search
MSTIYDVEIAGLRGEPLDLGQFRGTATLIVNVASRCGMTPQYETLEELQKRYADRGFTVL
GVPCNQFAGQEPGTADEIAEFCSATYGVTFPLTEKVEVNGDGRHPLYQALTAEPDAEGYT
GDVRWNFEKFLVGPDGTVVARFAPQTAPDAPEVITAIDAALARQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccatctatgacgtggagatcgccggcctgcgcggcgagccgctggacctcggg
cagttccggggcacggccacactcatcgtcaacgtggcctcccgctgcgggatgaccccg
cagtacgagacgctcgaggagctgcagaaacggtacgccgatcggggcttcaccgtgctc
ggcgtgccgtgcaaccagttcgccgggcaggagccgggcaccgccgacgagatcgccgag
ttctgcagcgcgacctacggcgtgacgttcccgctgaccgagaaggtggaggtcaacggc
gacgggcggcacccgctctaccaggcgctgaccgccgagccggacgccgagggctatacc
ggtgacgtccggtggaacttcgagaagttcctggtcggcccggacggcacggtcgtcgcc
cggttcgccccgcagaccgccccggacgcccccgaggtgatcaccgccatcgacgcggcg
ctcgcgcgccagtaa

DBGET integrated database retrieval system